DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCG and dpf-2

DIOPT Version :10

Sequence 1:NP_002045.1 Gene:GCG / 2641 HGNCID:4191 Length:180 Species:Homo sapiens
Sequence 2:NP_510461.1 Gene:dpf-2 / 181579 WormBaseID:WBGene00001055 Length:829 Species:Caenorhabditis elegans


Alignment Length:51 Identity:12/51 - (23%)
Similarity:20/51 - (39%) Gaps:1/51 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   122 WLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTI-LDNLAARDFINWL 171
            |:.....|..||.|...:..|..:|.||:..:.:..: ||.........|:
 Worm   406 WVSPKDVRGVFPTETGFLTVLPHKHDDGNIYNHVAHVELDGTGTGKITKWI 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCGNP_002045.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..59
Hormone_2 53..80 CDD:459681
Hormone_2 98..125 CDD:459681 1/2 (50%)
Hormone_2 146..173 CDD:459681 6/27 (22%)
dpf-2NP_510461.1 DPPIV_N 152..536 CDD:395744 12/51 (24%)
Peptidase_S9 625..801 CDD:459761
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.