| Sequence 1: | NP_002045.1 | Gene: | GCG / 2641 | HGNCID: | 4191 | Length: | 180 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_510461.1 | Gene: | dpf-2 / 181579 | WormBaseID: | WBGene00001055 | Length: | 829 | Species: | Caenorhabditis elegans |
| Alignment Length: | 51 | Identity: | 12/51 - (23%) |
|---|---|---|---|
| Similarity: | 20/51 - (39%) | Gaps: | 1/51 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Human 122 WLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTI-LDNLAARDFINWL 171 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GCG | NP_002045.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 26..59 | ||
| Hormone_2 | 53..80 | CDD:459681 | |||
| Hormone_2 | 98..125 | CDD:459681 | 1/2 (50%) | ||
| Hormone_2 | 146..173 | CDD:459681 | 6/27 (22%) | ||
| dpf-2 | NP_510461.1 | DPPIV_N | 152..536 | CDD:395744 | 12/51 (24%) |
| Peptidase_S9 | 625..801 | CDD:459761 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||