DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCG and dpf-4

DIOPT Version :10

Sequence 1:NP_002045.1 Gene:GCG / 2641 HGNCID:4191 Length:180 Species:Homo sapiens
Sequence 2:NP_001379734.1 Gene:dpf-4 / 175821 WormBaseID:WBGene00001057 Length:643 Species:Caenorhabditis elegans


Alignment Length:34 Identity:8/34 - (23%)
Similarity:19/34 - (55%) Gaps:1/34 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    87 NIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI 120
            ::|.::...:.|.|...:|::.: ||....:||:
 Worm   342 DLANKNFPLKVHRESRDSSEIDA-LEISEPEEFV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCGNP_002045.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..59
Hormone_2 53..80 CDD:459681
Hormone_2 98..125 CDD:459681 7/23 (30%)
Hormone_2 146..173 CDD:459681
dpf-4NP_001379734.1 TolB 100..247 CDD:440585
DAP2 375..627 CDD:441115 8/34 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.