DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Map2k6 and hep

DIOPT Version :9

Sequence 1:XP_036012601.1 Gene:Map2k6 / 26399 MGIID:1346870 Length:347 Species:Mus musculus
Sequence 2:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster


Alignment Length:319 Identity:145/319 - (45%)
Similarity:199/319 - (62%) Gaps:20/319 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    41 TPPR----DLDSKACI--------SIGNQNFEVKADDLEPIVELGRGAYGVVEKMRHVPSGQIMA 93
            |||.    :.|.|..|        :|..:.:....:||:.:.:||.|..|.|.||.|:.|..|:|
  Fly   160 TPPHPPVSETDMKLKIIMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIA 224

Mouse    94 VKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVID 158
            ||::|.|.|::|.||:||||||.:::.||.:.|...|...|:.|||||||||....||..|  :.
  Fly   225 VKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLK--LS 287

Mouse   159 KGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGYLVDSVAK 223
            | :.:||.||||:.|:.|.||.:|..|..||||||||||:||:..|.:|:|||||||.||||.|.
  Fly   288 K-KPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKAN 351

Mouse   224 TIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPS 288
            |..|||..|||||||:|:  :..|.:::|:||||||::|||..|.||:...|.|:.|.:|::...
  Fly   352 TRSAGCAAYMAPERIDPK--KPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEP 414

Mouse   289 PQLPADK---FSADFVDFTSQCLKKNSKERPTYPELMQHPFFTVHESKAADVASFVKLI 344
            |.||..:   ||..|.||..:||.||.::||.||||:..||..::||...||.::.:.|
  Fly   415 PCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSI 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Map2k6XP_036012601.1 PKc_MKK3_6 64..346 CDD:173729 138/284 (49%)
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 139/298 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.