DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Map2k3 and hep

DIOPT Version :9

Sequence 1:NP_032954.1 Gene:Map2k3 / 26397 MGIID:1346868 Length:347 Species:Mus musculus
Sequence 2:NP_001368982.1 Gene:hep / 32256 FlyBaseID:FBgn0010303 Length:1294 Species:Drosophila melanogaster


Alignment Length:320 Identity:142/320 - (44%)
Similarity:197/320 - (61%) Gaps:20/320 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    38 PTPPRNLDSRT------------FITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIM 90
            ||||....|.|            .:.|..|.:..:.:||..:.:||.|..|.|.|:.|..|.||:
  Fly   159 PTPPHPPVSETDMKLKIIMEQTGKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTII 223

Mouse    91 AVKRIRATVNTQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVL 155
            |||::|.|.|.:|.||:|||||:.:::.||.|.|...|...|:.|||||||||....||..:  |
  Fly   224 AVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLK--L 286

Mouse   156 EKNMKIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVA 220
            .|. .:||.|||::.|:.|.||.:|..|..||||||||||:||::.|::|:|||||||.||||.|
  Fly   287 SKK-PVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKA 350

Mouse   221 KTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEP 285
            .|..|||..|||||||:|:  :..|::::||||||||::|:|..|.|||...|.|:.|.:|::..
  Fly   351 NTRSAGCAAYMAPERIDPK--KPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSE 413

Mouse   286 SPQLPADQ---FSPEFVDFTSQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEI 342
            .|.||..:   ||.:|.||..:||.||..:|..|.||:..||..::::.|.|:..:.:.|
  Fly   414 PPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSI 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Map2k3NP_032954.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 4/6 (67%)
PKc_MKK3_6 62..344 CDD:173729 134/284 (47%)
hepNP_001368982.1 PKc_MKK7 181..476 CDD:270791 136/298 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D470057at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.