DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Map2k2 and lic

DIOPT Version :9

Sequence 1:NP_075627.2 Gene:Map2k2 / 26396 MGIID:1346867 Length:401 Species:Mus musculus
Sequence 2:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster


Alignment Length:341 Identity:114/341 - (33%)
Similarity:183/341 - (53%) Gaps:59/341 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    66 ELKDDDFERISELGAGNGGVVTKARHRPSGLIMARKLIHLEIKPAVRNQIIRELQV-LHECNSPY 129
            ::..|..|:|.:||.|..|:|.|.||:.:..::|.|.|.:.:....:::::.:|.: :...:.||
  Fly    40 DIDADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPY 104

Mouse   130 IVGFYGAFYSDGEISICMEHMDGGSLD----QVLKEAKRIPEDILGKVSIAVLRGLAYLREKHQI 190
            .|.||||.|.:|::.||||.| ..|||    :|.....|:.|.:|||::::|:..|.||..:.::
  Fly   105 TVHFYGAMYREGDVWICMEVM-STSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKV 168

Mouse   191 MHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSF-VGTRSYMSPERL--QG--THYSVQSDI 250
            :||||||||||:|..|::|:||||:||.|:||:|.:. .|.:.||:|||:  ||  ..|.::||:
  Fly   169 IHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDV 233

Mouse   251 WSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRPPGRPISVGHGMDSRP 315
            ||:|:.::|:|.||||.                            ...|.|              
  Fly   234 WSLGIGMIEMATGRYPY----------------------------DNWRTP-------------- 256

Mouse   316 AMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERADLKLLMNHAFIKRSEGEEVDF 380
                ||.|..:|.:.||:||.|.||.:|::|:..||.|....|.:.:.|:.|:||........|.
  Fly   257 ----FEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARPNYEQLLKHSFIVEHLQRNTDI 317

Mouse   381 AGWLCRTLRL--KQPS 394
            :.::.|.|.|  .||:
  Fly   318 SEFVARILDLPDAQPA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Map2k2NP_075627.2 PKc_MEK 70..388 CDD:132946 110/327 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..310 2/27 (7%)
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 110/328 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2221
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.