DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decr2 and CG12171

DIOPT Version :9

Sequence 1:NP_036063.1 Gene:Decr2 / 26378 MGIID:1347059 Length:292 Species:Mus musculus
Sequence 2:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster


Alignment Length:249 Identity:80/249 - (32%)
Similarity:132/249 - (53%) Gaps:8/249 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse    27 QDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVGRSLQKVTTAAKKLVAATGKRCLPLSMDVRVPP 91
            :|||..:||..||||...:.:..:.|....||||:|.|:...|:::|||.|...|.::.|:....
  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSES 69

Mouse    92 EVMTAVDQALQEFGKINILINCAAGNFLCPASALSFNAFKTVVDIDTIGTFNVSSVLYKKFFRDH 156
            :|...|...|.:.|:|::|:|.|....|......|...|..|::.:....:.::.::..:..:..
  Fly    70 DVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK 134

Mouse   157 GGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLR 221
            |. |||:::...:|.....|....:|||||..||.:|:|..|:.:||||:.||.|. || |:|..
  Fly   135 GN-IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII-TE-LQRRG 196

Mouse   222 GSNASSKLKHF-----SNPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGG 270
            |.:..:.:|..     ::.:.|.|...|:|.::.:|||..||:.:||.|.||||
  Fly   197 GLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Decr2NP_036063.1 TER_DECR_SDR_a 26..273 CDD:187627 80/249 (32%)
PRK07576 26..271 CDD:236056 80/249 (32%)
Substrate binding. /evidence=ECO:0000250 126..128 1/1 (100%)
Microbody targeting signal. /evidence=ECO:0000250 290..292
CG12171NP_649563.1 fabG 2..251 CDD:235975 80/249 (32%)
NADB_Rossmann 4..254 CDD:304358 80/249 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1710
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.