DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBX2 and bap

DIOPT Version :10

Sequence 1:NP_001476.2 Gene:GBX2 / 2637 HGNCID:4186 Length:348 Species:Homo sapiens
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:77 Identity:35/77 - (45%)
Similarity:50/77 - (64%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   228 LEETPPSSGAAGSTTSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVK 292
            |..:|..|..:...:...:.:|.|.||:..|:.|||:.|..::|||..|||::|.:|:|:|.|||
  Fly   156 LSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVK 220

Human   293 IWFQNRRAKWKR 304
            |||||||.|.||
  Fly   221 IWFQNRRYKTKR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBX2NP_001476.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 4/22 (18%)
Homeodomain 248..304 CDD:459649 30/55 (55%)
bapNP_732637.1 Homeodomain 176..232 CDD:459649 30/55 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.