DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ceacam10 and nrm

DIOPT Version :9

Sequence 1:NP_031701.3 Gene:Ceacam10 / 26366 MGIID:1347248 Length:265 Species:Mus musculus
Sequence 2:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster


Alignment Length:288 Identity:63/288 - (21%)
Similarity:99/288 - (34%) Gaps:85/288 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 ELASAHLHKGQVPWVGLLLTASLLTYWSPATTAQVTVEAVP------------------------ 42
            :|.|.:..||......:||..|.:|..:.....:||||..|                        
  Fly    70 KLHSLNWFKGDDRIAAMLLGDSNVTSVNKEFDERVTVEQNPYRLVIKDLKIADEDIYLCDTTFFI 134

Mouse    43 PNVTADN------NVLLLVHNLPQTLRVFYWYKGNSGAGHNEIGRFVTSINRSKMGLAHSGRETI 101
            |..|.||      .:.:||   |.|..|....||:.....:.:|...   .|..:....:.|.|.
  Fly   135 PEETCDNFNGYRIELRVLV---PPTEVVILDAKGDRIKNGSVVGPMQ---ERQSLKATCTVRNTR 193

Mouse   102 YSNGSLFFQSVTK-------ND--EGVYTLYM-LD---------------------QNFEITPIS 135
            ......:|:...:       :|  :|:||..: ||                     ||..:|..|
  Fly   194 PQPEVSWFRGTKRLTTYSPTHDLVDGLYTSTLELDWTLSREDLAQDIECRVKSAAIQNVTVTKFS 258

Mouse   136 VRFHVHPSLLPSLSPPTTGQVTVEAVRPNVAEGENVLLL--VHNLPRTLRAIYWYRGTT---AGE 195
            |...|.|:           .:.:..|:.:..:|..|:|.  :|. .|....:.||..||   :||
  Fly   259 VDLQVRPT-----------SIDINGVKHHTVQGSKVVLTCDIHG-ARPAVNLTWYNTTTIISSGE 311

Mouse   196 RNEIARFITASNKIILGPAHSDREIIYN 223
             |||....:.|.:...|..|:..|:|:|
  Fly   312 -NEITEVRSKSLEKSDGTFHTQSELIFN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ceacam10NP_031701.3 Ig_CEACAM_D1 36..140 CDD:319315 32/164 (20%)
Ig_CEACAM_D1 156..260 CDD:319315 21/73 (29%)
nrmNP_001246890.1 Ig 44..152 CDD:299845 17/81 (21%)
Ig 176..248 CDD:299845 10/74 (14%)
Ig 277..354 CDD:299845 20/64 (31%)
IG_like 383..463 CDD:214653
Ig 394..463 CDD:143165
Ig_3 585..652 CDD:290638
Ig 685..>719 CDD:299845
IG_like 788..869 CDD:214653
Ig <811..869 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.