DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBX1 and Ubx

DIOPT Version :9

Sequence 1:NP_001092304.1 Gene:GBX1 / 2636 HGNCID:4185 Length:363 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:351 Identity:94/351 - (26%)
Similarity:124/351 - (35%) Gaps:118/351 - (33%)


- Green bases have known domain annotations that are detailed below.


Human     5 GGGSAPGGNGGGGGGGPGTAFSID-----SLIGPPPPRSGHLLYTGYPMFMPYRP-LVLPQALAP 63
            |||...||.||||.||.|.|.:.:     :..|...|..|          ||.|| ...|.:...
  Fly   111 GGGGGGGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGG----------MPVRPSACTPDSRVG 165

Human    64 APL-PAGLPPLAPLASFAGRLTNTFCAGLGQA--VPSMVALTTALPSFAEPPDAFYGPQELAAAA 125
            ..| .:|..|::.....||...:. ..|.|.|  |.|.|.:..|       ..|:.....::.||
  Fly   166 GYLDTSGGSPVSHRGGSAGGNVSV-SGGNGNAGGVQSGVGVAGA-------GTAWNANCTISGAA 222

Human   126 AAAAATAARNNPEPGGRRPEGGLEADELLPAREKVAEPPPPPPPHFSETF----------PSLPA 180
            |..||.::.:...                                 :.||          |..|.
  Fly   223 AQTAAASSLHQAS---------------------------------NHTFYPWMAIAGECPEDPT 254

Human   181 EGKVYSSDEEKLEASAGDPAGSEQEEEGSGGDSEDDG--FLDSSAGGPGALLGPKPKLKGSLGTG 243
            :.|:.|...:                  .||.|.|.|  :.:|.||.         .|...||| 
  Fly   255 KSKIRSDLTQ------------------YGGISTDMGKRYSESLAGS---------LLPDWLGT- 291

Human   244 AEEGAPVTAGVTAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIW 308
                          .|..||.|..:|..|.||||||||...||:...|.::||||.|:|.|:|||
  Fly   292 --------------NGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIW 342

Human   309 FQNRRAKWKR----IKAGNVSSRSGE 330
            |||||.|.|:    ||..|...:..:
  Fly   343 FQNRRMKLKKEIQAIKELNEQEKQAQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBX1NP_001092304.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 13/30 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..265 23/148 (16%)
Homeobox 264..317 CDD:306543 30/52 (58%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.