DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBX1 and zen2

DIOPT Version :10

Sequence 1:NP_001092304.1 Gene:GBX1 / 2636 HGNCID:4185 Length:363 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:129 Identity:52/129 - (40%)
Similarity:73/129 - (56%) Gaps:18/129 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   246 EGAPVTAGVTAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQ 310
            |.||  ...|....||:|.||||:|.||:|||:|||..|||:.|.|.:|:..|.|:|.|||||||
  Fly    30 EAAP--TATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQ 92

Human   311 NRRAKWKRIKAGN-------------VSSRSGEPV-RNPKIVVPIPVHVNRFAVRSQHQQMEQG 360
            |||.|.|  |:.|             :||:|.|.: ::.:||..:..:.|.....:..:|::.|
  Fly    93 NRRMKLK--KSTNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHG 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBX1NP_001092304.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..265 7/18 (39%)
Homeodomain 262..318 CDD:459649 34/55 (62%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 35/57 (61%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.