DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBX1 and unpg

DIOPT Version :9

Sequence 1:NP_001092304.1 Gene:GBX1 / 2636 HGNCID:4185 Length:363 Species:Homo sapiens
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:452 Identity:155/452 - (34%)
Similarity:186/452 - (41%) Gaps:168/452 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    25 FSIDSLIG---------PPPPR---------------------SGHLLYTGYPMFMPY------- 52
            |||:|||.         |.||.                     |..|..|.:|::.|:       
  Fly    31 FSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLTQFPLYNPWLHGYFAQ 95

Human    53 -----RPLV-----LPQALAPAPLPAGLPPLAPLASFAGRLTNTFCAGLGQAVPS-------MVA 100
                 ..|:     ||.  :||..||...|.|                  ||.|.       ..|
  Fly    96 NHERLTHLIAGGCYLPS--SPAGHPAAQQPQA------------------QAQPQPPPPHPPTHA 140

Human   101 LTTAL-PSFAEPPDAFYGPQELAAAAAAAAATAARNNPE--------------------PGGRRP 144
            |...| |:...|.|..:.|...|||..|....:.|...|                    ..||..
  Fly   141 LEKQLPPTLPHPLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHMAAAGRMH 205

Human   145 EGGLEADELLPAREKVAEPPPPPPPHFSETFPSLPAEGKVYSSDEEKLEASAGDPAGSEQEEEGS 209
            |     |:..|...::.| |.||..|      |.||:...:|..|..|:      .|.:::.|.|
  Fly   206 E-----DQANPGMAQLQE-PTPPQAH------SSPAKSGSHSPMEPALD------VGMDEDFECS 252

Human   210 GGDSED----------DGFLDSSAGGP---------------------GALLGPKPKLKGSLGTG 243
            |....|          :|.:|.|..|.                     |.:.|     |.|.|.|
  Fly   253 GDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGG-----KDSQGNG 312

Human   244 AEEGAPVTAGVTAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIW 308
            :...:           ||||||||||||||||||:|||.|||||||||||||.:|||||||||||
  Fly   313 SSSNS-----------KSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIW 366

Human   309 FQNRRAKWKRIKAGNVS---SRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQ----GARP 363
            ||||||||||:|||..|   .|:| .....|||||||||||||||||||||:|:    |.:|
  Fly   367 FQNRRAKWKRVKAGLTSHGLGRNG-TTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLSGPKP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBX1NP_001092304.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..265 37/187 (20%)
Homeobox 264..317 CDD:306543 48/52 (92%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 46/50 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160115
Domainoid 1 1.000 108 1.000 Domainoid score I6426
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4061
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003648
OrthoInspector 1 1.000 - - otm42097
orthoMCL 1 0.900 - - OOG6_106620
Panther 1 1.100 - - LDO PTHR24334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4817
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.