DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing1 and bip2

DIOPT Version :9

Sequence 1:NP_036049.2 Gene:Ing1 / 26356 MGIID:1349481 Length:279 Species:Mus musculus
Sequence 2:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster


Alignment Length:448 Identity:79/448 - (17%)
Similarity:139/448 - (31%) Gaps:190/448 - (42%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 SPANGEQIHLVNYVEDYLDSIESLPFD-----LQRNVSLMREID-----AKYQEI------LKEL 51
            |.|.|..:..::.|.|...|.:.:||.     :...:.:..|.:     :.|::|      |..|
  Fly   976 SLAGGADLIPLSRVSDSEYSSKIVPFSSLGGTIPNQIKISEEHNIFSTFSNYEDITITPTGLTSL 1040

Mouse    52 D----DYYEKFKRETDGTQKRRVLHCIQRALIRSQELG------DEKIQI--VSQMVELVENRSR 104
            :    .:::|.|:..:|..|::...  :....::.::|      |.||:.  ..|..|..:::.:
  Fly  1041 EPKMRKHHKKLKKVKEGKNKKKKEK--KDKSKKADQIGLPSFKSDRKIKANDKRQKKEKKKDKDK 1103

Mouse   105 QVDSHV----ELFE----AHQD--------------ISDGTGG-------------SGKAGQDKS 134
            |:..|:    |.|:    |:.|              :...|.|             |||:....|
  Fly  1104 QILVHIPDDTEEFDKVPLANNDEPVLKSSSMTINPSLGAATSGISPNQIPKLTLKLSGKSTLFSS 1168

Mouse   135 KSEAITQADK---------PNNKRSRRQRNNENRENASNNHDHDDITSGTPKEKKAKT------- 183
            ..:.:|.|.|         .|.||        .|:|:........:.:|.||.|:::|       
  Fly  1169 SEKEMTDAGKLKQTTILSSENKKR--------ERDNSPELARFSPLVTGPPKNKQSETLHLGNSS 1225

Mouse   184 ------------------------------SKKKKRSKAKAEREAS----PADLPIDPNE----- 209
                                          |.....:.|.:...||    |..|.:.|:.     
  Fly  1226 TAVLPVPSPVAVRAVQLPVSQTSSNSAGWLSNPNNSNTASSTLSASSVLLPQQLMLAPHTIMNNF 1290

Mouse   210 -PTYC-------------------------------------------------LCNQVSYGE-M 223
             |..|                                                 .|.:|..|. |
  Fly  1291 VPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAESSRPSSYVDAEGNRIWICPACGKVDDGSAM 1355

Mouse   224 IGCDNDECPIEWFHFSCVGLNHKPKGK--WYCPKCRGESEKTMDKALEKSKKERAYNR 279
            ||||..:.   |:|:.|||:...||..  |:|..|      ...|.:..|:|::..|:
  Fly  1356 IGCDGCDA---WYHWICVGITFAPKDNDDWFCRVC------VTKKRIHGSEKKKRRNK 1404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing1NP_036049.2 ING 15..111 CDD:315637 22/127 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..206 27/167 (16%)
PHD_ING1_2 212..256 CDD:277059 18/95 (19%)
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 262..279 3/16 (19%)
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 17/47 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.