DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ing1 and MESR4

DIOPT Version :9

Sequence 1:NP_036049.2 Gene:Ing1 / 26356 MGIID:1349481 Length:279 Species:Mus musculus
Sequence 2:NP_001097359.1 Gene:MESR4 / 36986 FlyBaseID:FBgn0034240 Length:2171 Species:Drosophila melanogaster


Alignment Length:300 Identity:58/300 - (19%)
Similarity:85/300 - (28%) Gaps:150/300 - (50%)


- Green bases have known domain annotations that are detailed below.


Mouse   108 SHVELFEAHQDISDGTGGSGKAGQ-------------------DKSKSEAIT-------QADKPN 146
            :|.:|..:...:|:|:..|...||                   |::.|..:.       |..||.
  Fly  1858 THRQLQSSMTRMSEGSSCSDADGQLKRSKRQRRPNKFYGYTSDDENMSAVLAPPLQVGMQLIKPQ 1922

Mouse   147 -------------NKRSRRQRNNENRENASNNHDHDDITSGTPKEKKAKT------SKKKKRSK- 191
                         ....:|.|||.|..:..::|.:..:...:.|..|.::      |:..||.| 
  Fly  1923 PPPQLTWAKEDLPTPPKQRNRNNNNSSHHHHSHSNGGMAGSSRKRSKQRSLFGAGGSRPAKRHKP 1987

Mouse   192 -------------------------------AKAEREAS----------------------PADL 203
                                           :..:.||.                      |..|
  Fly  1988 DPNDHLPPIPTLKIRPSLLPTTAPPSDSSESSSDDEEAEVNVTSVVPTPQPAPPPVLPTPLPVAL 2052

Mouse   204 PIDP---------NEP------------------------------------------TYCLCNQ 217
            |:.|         |:|                                          .||.|..
  Fly  2053 PVPPPPPPAATAFNQPIPPALLPNPGFATLQYFKANNIRYPIRPPAGARLAREGESVYCYCRCPY 2117

Mouse   218 VSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCR 257
            ....|||.||.|.|.||||||.|||:...|:|||:|.:||
  Fly  2118 DEVSEMIACDGDNCLIEWFHFECVGIMVAPQGKWFCAECR 2157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ing1NP_036049.2 ING 15..111 CDD:315637 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..206 27/189 (14%)
PHD_ING1_2 212..256 CDD:277059 24/43 (56%)
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 262..279
MESR4NP_001097359.1 C2H2 Zn finger 1272..1288 CDD:275368
C2H2 Zn finger 1295..1315 CDD:275370
C2H2 Zn finger 1323..1341 CDD:275370
PHD_ING 2110..2156 CDD:276980 24/45 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.