Sequence 1: | NP_036049.2 | Gene: | Ing1 / 26356 | MGIID: | 1349481 | Length: | 279 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097359.1 | Gene: | MESR4 / 36986 | FlyBaseID: | FBgn0034240 | Length: | 2171 | Species: | Drosophila melanogaster |
Alignment Length: | 300 | Identity: | 58/300 - (19%) |
---|---|---|---|
Similarity: | 85/300 - (28%) | Gaps: | 150/300 - (50%) |
- Green bases have known domain annotations that are detailed below.
Mouse 108 SHVELFEAHQDISDGTGGSGKAGQ-------------------DKSKSEAIT-------QADKPN 146
Mouse 147 -------------NKRSRRQRNNENRENASNNHDHDDITSGTPKEKKAKT------SKKKKRSK- 191
Mouse 192 -------------------------------AKAEREAS----------------------PADL 203
Mouse 204 PIDP---------NEP------------------------------------------TYCLCNQ 217
Mouse 218 VSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCR 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ing1 | NP_036049.2 | ING | 15..111 | CDD:315637 | 1/2 (50%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 115..206 | 27/189 (14%) | |||
PHD_ING1_2 | 212..256 | CDD:277059 | 24/43 (56%) | ||
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 | 262..279 | ||||
MESR4 | NP_001097359.1 | C2H2 Zn finger | 1272..1288 | CDD:275368 | |
C2H2 Zn finger | 1295..1315 | CDD:275370 | |||
C2H2 Zn finger | 1323..1341 | CDD:275370 | |||
PHD_ING | 2110..2156 | CDD:276980 | 24/45 (53%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5034 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1434088at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |