DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPB8 and CG13133

DIOPT Version :9

Sequence 1:NP_055180.1 Gene:HSPB8 / 26353 HGNCID:30171 Length:196 Species:Homo sapiens
Sequence 2:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster


Alignment Length:134 Identity:41/134 - (30%)
Similarity:59/134 - (44%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    43 DLTASWPDWALPRLSSAW-PGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFK 106
            ||.....|:.|....||| .|:...|.|           |...|..|.......:||.::||.|:
  Fly    44 DLDVCARDFHLRMDDSAWCHGSCLVGRV-----------VIETGTEPDSLGRGTFKVVLDVHHFQ 97

Human   107 PEELMVKTKDG-YVEVSGKHEEKQQEGG--IVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEA 168
            ..||.||.|:. .|.|.||..:.:.|.|  .:::.||:..:||...|.....|:.|.:|:|:|..
  Fly    98 ISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQARATFSADGILMITV 162

Human   169 PQVP 172
            |..|
  Fly   163 PAPP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPB8NP_055180.1 ACD_HspB8_like 80..170 CDD:107235 29/92 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 26/75 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.