DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPB8 and CG14207

DIOPT Version :9

Sequence 1:NP_055180.1 Gene:HSPB8 / 26353 HGNCID:30171 Length:196 Species:Homo sapiens
Sequence 2:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster


Alignment Length:84 Identity:31/84 - (36%)
Similarity:50/84 - (59%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    97 KVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPE 161
            |:..:|..:.|||::|||.|..:.|..|||||..... |.:.:.::..||..|:|.::.:|||.:
  Fly   105 KLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKD 168

Human   162 GLLIIEAPQVPPYSTFGES 180
            |:|.::||.  |..|.||:
  Fly   169 GVLTVDAPL
--PALTAGET 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPB8NP_055180.1 ACD_HspB8_like 80..170 CDD:107235 26/72 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196 3/5 (60%)
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148946
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.