DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GBP2 and atln-2

DIOPT Version :9

Sequence 1:NP_004111.2 Gene:GBP2 / 2634 HGNCID:4183 Length:591 Species:Homo sapiens
Sequence 2:NP_502809.2 Gene:atln-2 / 189829 WormBaseID:WBGene00012763 Length:520 Species:Caenorhabditis elegans


Alignment Length:457 Identity:96/457 - (21%)
Similarity:183/457 - (40%) Gaps:84/457 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAPEINLPGPMSLIDNTKGQLVVNPEALKIL----SAITQPVVVVAIVGLYRTGKSYLMNKLAG- 60
            :||....||...|          |..||..:    :...:.:|::::.|.:|.|||:|:|.... 
 Worm    33 IAPSSTQPGKFRL----------NESALNSVLGHSACANKKIVIISVAGAFRKGKSFLLNFFLEY 87

Human    61 ---------------------KKNGFSLGSTVKSHTKGIWMWCVP----HPKKPEHTLVLLDTEG 100
                                 :.:||...:.||..|.|||:|..|    ........:||:||:|
 Worm    88 LYSLHKSQQSDSSLEWLTDDCQLHGFHWRAGVKRDTVGIWLWGEPIMIESVTGEMFAVVLMDTQG 152

Human   101 LGDIEKGDNENDSW-----IFALAILLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGN 160
            ..|      .|.::     :|||:.::||..:||.:..|.:.|:..|....|.          |.
 Worm   153 TFD------NNSTYQQCMTVFALSTIVSSVQIYNVVDNIQEDALQHLSLFVEY----------GR 201

Human   161 NSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIR 225
            .:::...:|...|...|:.:|||..:.|.:.......|:|:..|:.   ..::.:.....|..:|
 Worm   202 IAMEQPHNFGKPFQQLVFCVRDFKNQEEYEFGENGGTDFLDNVLQT---NPEQPEEIKQVRELLR 263

Human   226 KFFPKRKCFVFDWPAPK-----KYLAHLEQLKEEELNPDFIEQVAEFCSYILS-HSNVKTLSGGI 284
            ::|...:|::...|..|     .:..|:     ::|.|.|.|::.:....:|. |.....:..|.
 Worm   264 EYFEDIQCYLLPHPGYKVAERQSFRGHV-----KDLRPLFREELKKMVPNLLGPHILKPKIVNGK 323

Human   285 PVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVEKAIAHYEQQMGQK---VQLPTE 346
            .|...::......|..:.....||..::.:.|.|::....|..:|..:|.:.|.:.   .::.:|
 Worm   324 TVTCRKMIQYFKEYAASFDGETLPQPQSILNANAKLICIEAAHEAKVNYSRGMDRSTYGTRMMSE 388

Human   347 TLQELLDLHRDSEREAIEVFMK---NSFKDVDQMFQRKLGAQLEARRDDFCKQN-SKASSDCCMA 407
              ::||:.|......|:.:|.|   ...|:|..:...||...:.|..:.:.:.| :|..:.|..|
 Worm   389 --KKLLEAHIKHGITALNIFDKCPRIGAKEVRNLLLEKLQEDINAELEKYKRLNEAKRVTGCASA 451

Human   408 LL 409
            :|
 Worm   452 ML 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GBP2NP_004111.2 GTPase domain (Globular). /evidence=ECO:0000250 1..309 72/348 (21%)
GBP 18..280 CDD:308078 63/302 (21%)
GBP_C 282..578 CDD:308475 28/135 (21%)
atln-2NP_502809.2 P-loop_NTPase 41..310 CDD:393306 63/302 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.