DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ogt and Utx

DIOPT Version :9

Sequence 1:XP_006257118.1 Gene:Ogt / 26295 RGDID:62060 Length:1046 Species:Rattus norvegicus
Sequence 2:NP_609368.3 Gene:Utx / 34377 FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster


Alignment Length:545 Identity:117/545 - (21%)
Similarity:197/545 - (36%) Gaps:123/545 - (22%)


- Green bases have known domain annotations that are detailed below.


  Rat    69 RRLD-RSAHFSTLAIKQNP----LLAEAYSNLGNVYKERGQLQE-------------------AI 109
            |.|| |...|..|:..:|.    |:.:..:||.| |...||:.|                   |.
  Fly    13 RELDSRYYGFLDLSNSKNAELRNLVQQTITNLQN-YIANGQVHESKNSSDNKNAIQKFEPSTQAG 76

  Rat   110 EHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLE 174
            ||..:......|....:...|...|:..:.:...:.||:||       |   .||:|...||...
  Fly    77 EHMENTSSRNNDDTKPFEQDAKEKVSIIEEKHQDEHYVNAL-------C---KLGHLHLLLGEYS 131

  Rat   175 EAKACYLKAIETQPN-----------FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFL--- 225
            ||.:.|.|.:..:.|           ..||:..|.| |.     | ||..|::.:.|.|||.   
  Fly   132 EALSAYQKYLRFRENNYWTNHAFIYGIGVAYFKLRC-FK-----W-AIKSFQELLYLSPNFTCAN 189

  Rat   226 DAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAI-ELQ 289
            :.::.||.:||....|               :.|:.|..||.:|           ||.... |||
  Fly   190 EVHLRLGLMLKHCGEF---------------HIALKHLQLALLY-----------TYPSTFSELQ 228

  Rat   290 PHFPDAYCNLANALKEKGSVAEAEDCY-------NTALRLCPTHAD----------SLNNLANIK 337
            ..|     .:|:..:.:.....|:|.|       |.:|.|   .||          .:..|...|
  Fly   229 VKF-----QIAHLYEVQNKHKAAKDGYEFLLNEKNISLEL---KADVYRQLGWMYHCVECLGEKK 285

  Rat   338 REQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG 402
            ..:.|   |:...:|::|..|:...:...|........|:.:|.:.|:.::..|...||.:.::|
  Fly   286 EREAN---ALNFLQKSIEADPKSGQSLYLLGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIG 347

  Rat   403 NTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYC 467
            ...::......|||.|..|:|::.....|.:||..:::..|.:.:|.|.|..|.|.......:..
  Fly   348 VLYQQQNQPTDALQAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISFQKSSLI 412

  Rat   468 NLAHCLQIVCDWTDYDERMKKLVSIVAEQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCL 532
            .....:::..|.....:.:.:.::.:..||.:..|||:......|..:...:...|:....:...
  Fly   413 RKKQAIRMKKDTIGLSKGLSQRITFLEGQLSQAPLPSITSKRRQLCSIEEAWNLPISLEMNSRQQ 477

  Rat   533 DKINVLHK------------PPYEH 545
            ....:|.:            |||.|
  Fly   478 QTAQMLPRQVTKQSPVQGPPPPYPH 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OgtXP_006257118.1 PEP_TPR_lipo <22..>465 CDD:274350 104/451 (23%)
TPR repeat 24..49 CDD:276809
TPR repeat 57..83 CDD:276809 6/14 (43%)
TPR repeat 89..117 CDD:276809 10/46 (22%)
TPR repeat 122..152 CDD:276809 6/29 (21%)
TPR repeat 157..185 CDD:276809 10/27 (37%)
TPR repeat 191..219 CDD:276809 9/27 (33%)
TPR repeat 226..253 CDD:276809 5/26 (19%)
TPR repeat 259..287 CDD:276809 7/28 (25%)
TPR repeat 293..321 CDD:276809 5/34 (15%)
TPR repeat 327..355 CDD:276809 7/37 (19%)
TPR repeat 360..390 CDD:276809 4/29 (14%)
TPR repeat 395..423 CDD:276809 8/27 (30%)
TPR repeat 429..457 CDD:276809 8/27 (30%)
Glyco_transf_41 476..1016 CDD:404688 13/82 (16%)
UtxNP_609368.3 TPR repeat 147..181 CDD:276809 9/40 (23%)
TPR_11 156..216 CDD:290150 21/81 (26%)
TPR repeat 186..216 CDD:276809 8/44 (18%)
TPR repeat 228..255 CDD:276809 6/31 (19%)
TPR_11 264..337 CDD:290150 13/75 (17%)
TPR repeat 265..300 CDD:276809 7/37 (19%)
TPR repeat 307..334 CDD:276809 4/26 (15%)
TPR_11 339..402 CDD:290150 17/62 (27%)
TPR repeat 339..369 CDD:276809 8/29 (28%)
TPR_1 340..373 CDD:278916 9/32 (28%)
TPR repeat 374..402 CDD:276809 8/27 (30%)
JmjC 870..978 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.