DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IL1RAPL2 and vlc

DIOPT Version :9

Sequence 1:NP_059112.1 Gene:IL1RAPL2 / 26280 HGNCID:5997 Length:686 Species:Homo sapiens
Sequence 2:NP_001163056.1 Gene:vlc / 46078 FlyBaseID:FBgn0259978 Length:605 Species:Drosophila melanogaster


Alignment Length:182 Identity:42/182 - (23%)
Similarity:70/182 - (38%) Gaps:60/182 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   513 KGKVNCQEVESLKRSIKLLSLIKWKGSKSSKLNSKFWKHLVYEMPIKKKEMLPRCHVLDSA---- 573
            :|:|   |::||:.| :|..  |:|....||...:|           :|:|..:|....:|    
  Fly   244 RGQV---EIDSLQGS-ELAR--KFKQLSPSKDYGEF-----------RKKMQKKCSQSTTARIDE 291

Human   574 ---EQGLFGELQPIPSIAMTSTSATLVSSQADLPEFHPSDSMQIRHCCRGYKHEIPATTLPVPSL 635
               ..||.|:|                    |||.|        ||..:.::.::|..:   |..
  Fly   292 PLHSPGLNGDL--------------------DLPVF--------RHLSQEFRAQLPTVS---PKR 325

Human   636 GNHHTYCNLPLTLL--NGQLPLNNTLKDTQEFHRNSSLLPLSSKELSFTSDI 685
            |...: |..|..||  |...|.:....:..  |.::.:..|:|:|...||:|
  Fly   326 GAPRS-CMAPDVLLVDNESSPDHGPTDEVD--HESTKMDKLASEEYISTSNI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IL1RAPL2NP_059112.1 Ig 32..133 CDD:325142
Ig2_IL1R_like 146..237 CDD:319309
IG_like 250..347 CDD:214653
TIR 402..563 CDD:307630 13/49 (27%)
vlcNP_001163056.1 GKAP 246..575 CDD:281368 41/180 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3971
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.