DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IL1RAPL2 and sns

DIOPT Version :9

Sequence 1:NP_059112.1 Gene:IL1RAPL2 / 26280 HGNCID:5997 Length:686 Species:Homo sapiens
Sequence 2:NP_001036532.1 Gene:sns / 44097 FlyBaseID:FBgn0024189 Length:1542 Species:Drosophila melanogaster


Alignment Length:321 Identity:68/321 - (21%)
Similarity:120/321 - (37%) Gaps:60/321 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    40 TYMALAGEPVRVKCALFYSYIRTNYSTAQSTGLRLMWYKNKGDLEEPIIFSEVRMSKEEDSIWFH 104
            |.:.:.||.::|.       ::|.   |..|.:...|.|:...:.:.   .:.|:..:..|:.|.
  Fly   687 TAVGVEGESLQVS-------LQTR---ANPTPVTYKWTKDGTTIPQD---GDHRIFADGGSLNFT 738

Human   105 SAEAQDSGFYTCVLRNSTYCMKVSMSLTVAENESGLCYNSRIRYLEKSEVTKRKE---ISCPDMD 166
            .....|:|.|:|...||.....:::::.|.       |.:.|:.:.::.|....|   :||....
  Fly   739 RLHRDDAGIYSCSASNSQGGATLNITVVV
E-------YGTTIKSVSENIVVNPGEDAMLSCTVEG 796

Human   167 DFKKSDQEPDVVWYK---ECKPKMWRSIIIQKGNALL-IQEVQEEDGGNYTCELKYEGKLVRRTT 227
               |...|..|.|.:   :...|  .|.....|.:.| |::.:.||.||:.|   .....|...|
  Fly   797 ---KPLTEEHVKWERVGYDMTVK--TSTTFANGTSYLHIKDAKREDVGNFRC---VADNRVDNPT 853

Human   228 ELKVTALLTDKPPKPLFPMENQPSVIDVQ--LGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEE 290
            ...:..::...|     .:...|:::...  .|:...:||:|    .|...|...|.:.:|.:. 
  Fly   854 NRDILLIVKFAP-----EIAKTPTLLRAASGTGERGRLPCRA----QGSPKPQFIWRQDKKDLP- 908

Human   291 LAGHIREGEIRLLKEHLGEKEV-----ELALIFDSVVEADLANYTCHVENRNGRKHASVLL 346
                |.    |..|..:.|:::     |..||.|.|..||...|.|...|..|....:|.|
  Fly   909 ----IN----RTYKYEVEERKIDSLTYESTLIVDKVAPADYGAYECVARNELGEAVETVRL 961

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IL1RAPL2NP_059112.1 Ig 32..133 CDD:325142 18/92 (20%)
Ig2_IL1R_like 146..237 CDD:319309 21/97 (22%)
IG_like 250..347 CDD:214653 26/104 (25%)
TIR 402..563 CDD:307630
snsNP_001036532.1 I-set 73..170 CDD:254352
Ig 76..155 CDD:299845
IG_like 186..279 CDD:214653
Ig 197..279 CDD:299845
IG_like 296..376 CDD:214653
Ig 300..361 CDD:299845
Ig 380..454 CDD:299845
IG_like 490..573 CDD:214653
Ig 501..560 CDD:299845
Ig 584..666 CDD:299845
IG_like 585..666 CDD:214653
I-set 678..767 CDD:254352 18/92 (20%)
IGc2 692..757 CDD:197706 17/77 (22%)
Ig 788..849 CDD:143165 16/68 (24%)
Ig 885..960 CDD:143165 22/87 (25%)
FN3 967..1051 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.