DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IL1RAPL2 and Toll-6

DIOPT Version :9

Sequence 1:NP_059112.1 Gene:IL1RAPL2 / 26280 HGNCID:5997 Length:686 Species:Homo sapiens
Sequence 2:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster


Alignment Length:392 Identity:83/392 - (21%)
Similarity:149/392 - (38%) Gaps:121/392 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   298 GEIRLLKEHLGEKEVELALIFDSVVEADLANYTCHVENRNGRKHASVLLRKKDLIYKIELAGGL- 361
            |.:...:.:||:...::         .|.:..:|...|      |:.:||:|:.. |..|..|: 
  Fly   996 GYLARFRNYLGQSSEKI---------IDASRVSCIYNN------ATSVLREKNGT-KCTLRDGVA 1044

Human   362 ---------GAIFLLLVL---------LVVIYKCYNIELMLFYRQHFGADETN------------ 396
                     |.:.||||.         |:....||..||.::      |..||            
  Fly  1045 HYMHTNEIEGLLPLLLVATCAFVAFFGLIFGLFCYRHELKIW------AHSTNCLMNFCYKSPRF 1103

Human   397 ----DDNKEYDAYLSYTKVDQDTLDCDNPEEEQFALEVLPDVLEKHYGYKLFIPERDLIPSGTYM 457
                |..:..|||.:|:.           ::|.|..::|...||...||:|.:..||:..:....
  Fly  1104 VDQLDKERPNDAYFAYSL-----------QDEHFVNQILAQTLENDIGYRLCLHYRDVNINAYIT 1157

Human   458 EDLTRYVEQSRRLIIVLTPDYILRRGWSIFELESRLHNMLVSGEIKVILIECTELKGKVNCQEVE 522
            :.|....|.:::.::||:.:::... ||.||.:|.||. ||....:|:.|    |.|.:..::::
  Fly  1158 DALIEAAESAKQFVLVLSKNFLYNE-WSRFEYKSALHE-LVKRRKRVVFI----LYGDLPQRDID 1216

Human   523 -SLKRSIKLLSLIKWKGSKSSKLNSKFWKHLVYEMPI------KKKEMLPRCHVLDSAEQGLFGE 580
             .::..::..:.|:|.       :.|||:.|...:|:      ..|.::..|         |.|.
  Fly  1217 MDMRHYLRTSTCIEWD-------DKKFWQKLRLALPLPNGRGNNNKRVVSGC---------LSGR 1265

Human   581 LQPIPSIAMTSTS--------ATLVSSQADLPEFHPSDSMQIRHCC-----RGYKHEIPATTLPV 632
               .||:.|.:||        ..:....|...:...::...|..|.     ||||        |:
  Fly  1266 ---TPSVNMYATSHEYQAGNGGVIPPPSARYADCGSNNYATINECAAAGGGRGYK--------PI 1319

Human   633 PS 634
            |:
  Fly  1320 PT 1321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IL1RAPL2NP_059112.1 Ig 32..133 CDD:325142
Ig2_IL1R_like 146..237 CDD:319309
IG_like 250..347 CDD:214653 7/48 (15%)
TIR 402..563 CDD:307630 39/167 (23%)
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380
leucine-rich repeat 229..249 CDD:275380
LRR_RI 278..468 CDD:238064
leucine-rich repeat 279..302 CDD:275380
LRR_8 301..386 CDD:290566
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380
LRR 350..729 CDD:227223
leucine-rich repeat 352..375 CDD:275380
leucine-rich repeat 376..401 CDD:275380
LRR_RI <401..626 CDD:238064
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 426..449 CDD:275380
leucine-rich repeat 450..473 CDD:275380
leucine-rich repeat 474..497 CDD:275380
leucine-rich repeat 498..518 CDD:275380
leucine-rich repeat 521..544 CDD:275380
leucine-rich repeat 545..566 CDD:275380
leucine-rich repeat 569..592 CDD:275380
leucine-rich repeat 593..615 CDD:275380
leucine-rich repeat 616..637 CDD:275380
leucine-rich repeat 638..662 CDD:275380
leucine-rich repeat 663..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..728 CDD:275380
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587 38/156 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10655
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8062
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.