Sequence 1: | NP_059112.1 | Gene: | IL1RAPL2 / 26280 | HGNCID: | 5997 | Length: | 686 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163142.1 | Gene: | mars / 36498 | FlyBaseID: | FBgn0033845 | Length: | 921 | Species: | Drosophila melanogaster |
Alignment Length: | 211 | Identity: | 45/211 - (21%) |
---|---|---|---|
Similarity: | 77/211 - (36%) | Gaps: | 62/211 - (29%) |
- Green bases have known domain annotations that are detailed below.
Human 515 KVNCQEVESLKRS--------IKLLSLIKWKGSKSS-------------------KLNSKFWKHL 552
Human 553 VYEMP-----IKKKEMLP------RCHVLDSAE-QGLFGELQPI-PSIAMTSTSATLVSSQADLP 604
Human 605 EFHPSDSMQIRHCCRGYKHEIPATTLPVPSLGNHHTYCNLPLTLLNGQL---PLNNTLKDTQEFH 666
Human 667 RNSSLLPLSSKELSFT 682 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
IL1RAPL2 | NP_059112.1 | Ig | 32..133 | CDD:325142 | |
Ig2_IL1R_like | 146..237 | CDD:319309 | |||
IG_like | 250..347 | CDD:214653 | |||
TIR | 402..563 | CDD:307630 | 13/79 (16%) | ||
mars | NP_001163142.1 | GKAP | <558..>703 | CDD:281368 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3971 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |