DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IL1RAPL2 and Fas2

DIOPT Version :9

Sequence 1:NP_059112.1 Gene:IL1RAPL2 / 26280 HGNCID:5997 Length:686 Species:Homo sapiens
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:488 Identity:100/488 - (20%)
Similarity:157/488 - (32%) Gaps:188/488 - (38%)


- Green bases have known domain annotations that are detailed below.


Human     3 PP----FLLALVVCS--------VVSTNLKMVSKRNSVDGCIDWSVDLKTYMALAGEPVRVKCAL 55
            ||    ..|||::||        ..|..|::..|:         .|..|.    .|:|:.:.|. 
  Fly     5 PPNSVGVFLALLLCSCSLIELTRAQSPILEIYPKQ---------EVQRKP----VGKPLILTCR- 55

Human    56 FYSYIRTNYSTAQSTGL--RLMWYKNKGDL--------EEPIIFSEVRMSKEEDSIWFHSAEAQD 110
                     .|.....|  .|.|..|:.:.        .:|.:::|. :..|..::...|...:.
  Fly    56 ---------PTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTET-LPGESLALMITSLSVEM 110

Human   111 SGFYTCVLRNSTYCMKVSMSLTVAENESGLCYNSRIRYLEKSEV---------TKRKEISCPDM- 165
            .|.|.|   .::|.                  |:.|  |||...         |...|...|.: 
  Fly   111 GGKYYC---TASYA------------------NTEI--LEKGVTIKTYVAITWTNAPENQYPTLG 152

Human   166 DDF-----KKSDQEPDVVWYKECKP-KMWRSIIIQKGNALLIQEVQEEDGGNYTCELKY--EGKL 222
            .|:     .|:|..|.:.|.:...| :......:.:.|.|||:.|||.|.|.|||....  .|:|
  Fly   153 QDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCRAAVIETGEL 217

Human   223 VRRTTELKVTALLTDKPPKPLFPMENQPSVIDVQL------GKPLNIPCKAFFGFSGESGPMIYW 281
            :.||..::|..               ||.:|.:..      |||....|.|    .|:..|.|.|
  Fly   218 LERTIRVEVFI---------------QPEIISLPTNLEAVEGKPFAANCTA----RGKPVPEISW 263

Human   282 MKGEKFIEELAGHIREG-EIRLLKEHLGEKEVELALI-FDSVVEADLANYTCHVENRNG----RK 340
                         ||:. ::.:......:...:..|: ..||.:.|...|||..:||.|    :.
  Fly   264 -------------IRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKT 315

Human   341 HASVLLRKKDLIYKIELAGGLGAIFLLLVLLVVIYKCYNI------ELMLFYR-----------Q 388
            ..:||:|.:                        ||:.||:      |:.:..|           :
  Fly   316 KLNVLVRPQ------------------------IYELYNVTGARTKEIAITCRAKGRPAPAITFR 356

Human   389 HFGADETNDDNKEYDAYLSYTKVDQDTLDCDNP 421
            .:|..|            .||...||    |:|
  Fly   357 RWGTQE------------EYTNGQQD----DDP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IL1RAPL2NP_059112.1 Ig 32..133 CDD:325142 18/110 (16%)
Ig2_IL1R_like 146..237 CDD:319309 30/108 (28%)
IG_like 250..347 CDD:214653 25/108 (23%)
TIR 402..563 CDD:307630 6/20 (30%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 23/140 (16%)
IG_like 144..226 CDD:214653 24/81 (30%)
IGc2 152..209 CDD:197706 18/56 (32%)
I-set 230..319 CDD:254352 23/105 (22%)
IGc2 243..309 CDD:197706 20/82 (24%)
IG_like 330..424 CDD:214653 11/60 (18%)
IGc2 339..412 CDD:197706 9/51 (18%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.