DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN17 and Tsp3A

DIOPT Version :9

Sequence 1:NP_001353420.1 Gene:TSPAN17 / 26262 HGNCID:13594 Length:355 Species:Homo sapiens
Sequence 2:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster


Alignment Length:309 Identity:114/309 - (36%)
Similarity:158/309 - (51%) Gaps:60/309 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     7 HFQEPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEK--------------GVLSNISALTD 57
            ||  ..|..|.||.:|..|.|||:.|.|.|.||::|:.:|              .|..|||.   
  Fly    35 HF--TYVSQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLENFYDVFLNISL--- 94

Human    58 LGGLDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWIR 122
                    :.::.|.|:.::.|:||:||||||||||||:|:.|.|.|.||:|..|:.||...::.
  Fly    95 --------VMILAGTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMN 151

Human   123 DQL-NLFINNNVKAYRDDIDLQNLIDFAQEYWSCCGA--RGPNDWNLNIYFNCTDLNPSRERCGV 184
            ..| ..|.:..:.:||||.||||.|||||:.:.|||.  .|..||:.|.||||:  :||.|:|||
  Fly   152 TFLEKQFTHKIIHSYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCS--SPSVEKCGV 214

Human   185 PFSCCVR--DPAEDVLNTQCGYDVRLKLELEQQGFIHTKGCVGQFEKWLQDNLIVVAGVFMGIAL 247
            |:|||:.  |.:..::|..|||.|:.....|....|.|.||:.....|.:.||.|:||..:||||
  Fly   215 PYSCCINATDISSGLVNIMCGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIAL 279

Human   248 LQVPLWPHVPLPLPGPPSLSPHLSSVLQIFGICLAQNLVSDIKAVKANW 296
                                      :|:..|.||:.|...|:..|:.|
  Fly   280 --------------------------IQLLVIYLAKTLEGQIELQKSRW 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN17NP_001353420.1 TM4SF9_like_LEL 115..235 CDD:239412 50/124 (40%)
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 108/291 (37%)
penumbra_like_LEL 144..267 CDD:239411 50/124 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48585
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X349
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.