DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO24 and ntc

DIOPT Version :10

Sequence 1:NP_036304.2 Gene:FBXO24 / 26261 HGNCID:13595 Length:618 Species:Homo sapiens
Sequence 2:NP_647829.1 Gene:ntc / 38443 FlyBaseID:FBgn0035461 Length:314 Species:Drosophila melanogaster


Alignment Length:177 Identity:37/177 - (20%)
Similarity:64/177 - (36%) Gaps:39/177 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   248 QEVVGTTSSRACDCV------EVYLQSSGQRVFKMTFHHS------MTFKQIVLVGQETQRA--- 297
            |:||||...:|.|.|      .:..:.|.|....:...|:      ....:::...||.::.   
  Fly    33 QQVVGTKDIKAPDQVGKKQRPRLIQEKSTQETNPLILEHATLEWVPQHMDKLLNQYQECRKMPAA 97

Human   298 --LLLLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLYVTDQGGV 360
              |.|||....:....|.|....|.| :.:|......|.:..::|:            :::|...
  Fly    98 EWLHLLTYLVALECGFVEEETFAQKR-HLIQPVPSFSSFHAQNVRI------------LSEQPAR 149

Human   361 YFEVHTPGVYRDLFGTLQAFDPLDQQMP----LALSLPAKILFCALG 403
            |.......||.....||     ||:..|    |..:|..:::..:||
  Fly   150 YEVCFNDTVYIMRLRTL-----LDKHAPEETSLVAALQCRLMAVSLG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO24NP_036304.2 F-box_FBXO24 76..122 CDD:438870
ATS1 <401..>463 CDD:444065 2/3 (67%)
ntcNP_647829.1 F-box-like 267..>298 CDD:463757
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.