Sequence 1: | NP_055175.2 | Gene: | NKX2-8 / 26257 | HGNCID: | 16364 | Length: | 239 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_732637.1 | Gene: | bap / 42537 | FlyBaseID: | FBgn0004862 | Length: | 382 | Species: | Drosophila melanogaster |
Alignment Length: | 244 | Identity: | 81/244 - (33%) |
---|---|---|---|
Similarity: | 100/244 - (40%) | Gaps: | 83/244 - (34%) |
- Green bases have known domain annotations that are detailed below.
Human 28 REPEPRAPQPDP----CAAWLDSERGHYPSSDESSLET--------------------------- 61
Human 62 -----SPPDSSQRPSARPAS-PGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASL 120
Human 121 LRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAP--GLLRRVVVPVLVRDGQPCGG 183
Human 184 GGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPA----YQH 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NKX2-8 | NP_055175.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..87 | 21/95 (22%) | |
Homeobox | 87..140 | CDD:278475 | 37/52 (71%) | ||
bap | NP_732637.1 | Homeobox | 178..231 | CDD:278475 | 37/52 (71%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0842 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D450160at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |