DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATA1 and pnr

DIOPT Version :9

Sequence 1:NP_002040.1 Gene:GATA1 / 2623 HGNCID:4170 Length:413 Species:Homo sapiens
Sequence 2:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster


Alignment Length:297 Identity:130/297 - (43%)
Similarity:156/297 - (52%) Gaps:41/297 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    41 LDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCMEGIPGGSPYAGWAYGKTGLYP 105
            |.||::||:.|.:....||:..|       ||.....|..|    ...|.:..||...|.:|.:.
  Fly    32 LSAASASTSASASATHVAAVKMY-------HSSAVAAYTDL----AAAGSAASAGVGVGVSGYHQ 85

Human   106 ASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSS 170
            .:...|....|..|........||.:......||...        :..:....||:|.....:.|
  Fly    86 QAVNAPVYVPSNRQYNHVAAHFGSAAAQNAWTTEGFG--------SAHAQFYSPNAAVMMGSWRS 142

Human   171 TFFSPTG----SPLNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLCNACGLY 231
            . :.|:|    ||..||          :.....|.||||||||.:|||||||.||||||||||||
  Fly   143 A-YDPSGFQRSSPYESA----------MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLY 196

Human   232 HKMNGQNRPLIRPKKRLI---VSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNR 293
            |||||.|||||:|.|||:   .::|.|..||||.|.||||||||..|:|||||||||||||.|||
  Fly   197 HKMNGMNRPLIKPSKRLVSATATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNR 261

Human   294 PLTMRKDGIQTRNRKASGKGKKKRGSSLG-GTGAAEG 329
            ||.|||||||||.||....|.   ||::| |||:..|
  Fly   262 PLAMRKDGIQTRKRKPKKTGS---GSAVGAGTGSGTG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATA1NP_002040.1 Interaction with MED1 and CCAR1. /evidence=ECO:0000269|PubMed:24245781 200..330 95/134 (71%)
ZnF_GATA 202..247 CDD:214648 38/44 (86%)
ZnF_GATA 203..247 CDD:238123 37/43 (86%)
Required for interaction with ZFPM1 203..222 15/18 (83%)
Interaction with CALCOCO1. /evidence=ECO:0000269|PubMed:24245781 249..315 46/68 (68%)
ZnF_GATA <268..308 CDD:238123 33/39 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..327 18/30 (60%)
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648 39/47 (83%)
ZnF_GATA 168..212 CDD:238123 37/43 (86%)
ZnF_GATA 223..270 CDD:214648 37/46 (80%)
ZnF_GATA 226..276 CDD:238123 41/49 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1745
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.