DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B3GAT3 and GlcAT-S

DIOPT Version :9

Sequence 1:NP_036332.2 Gene:B3GAT3 / 26229 HGNCID:923 Length:335 Species:Homo sapiens
Sequence 2:NP_001162922.1 Gene:GlcAT-S / 34282 FlyBaseID:FBgn0032135 Length:486 Species:Drosophila melanogaster


Alignment Length:246 Identity:102/246 - (41%)
Similarity:134/246 - (54%) Gaps:24/246 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    74 LPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPLVSGLLAASGLLFTHLVVL 138
            ||.||.|||||.|..|..||.||:.||..:||||||:.:|.|.....:..||...|:.|||:|  
  Fly   207 LPVIYFVTPTYPRREQIPELTRLAHTLLHIPRLHWLVADDQEKCNDYMDTLLYRFGMPFTHMV-- 269

Human   139 TPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVYFADDDNTYSREL 203
            :|...:.|..:|.   ||||..|..||.|:|...            .|.|::||.||||||...|
  Fly   270 SPMPSKFRNEKPA---PRGVANRRAALQWIRQHN------------LTNGILYFGDDDNTYDLRL 319

Human   204 FEEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPSRPFPVDMAGFAVALPLLLDKP- 267
            |.|:|.|:.||::||||:......||.|:.|:||.|..:|...|.:|||||||||.|..:...| 
  Fly   320 FSEIRKTQRVSMFPVGLIADYGVSGPVVRKGKVVAFLDSWVAGRRWPVDMAGFAVNLEYMAQYPY 384

Human   268 -NAQFDSTAPRGHLESSLLSHL-VDPKDLEPRAANCTRVLVWHTRTEKPKM 316
             |..:..    |:.|...|..: :....:|||..|||.:|||||:|:..|:
  Fly   385 VNMPYKP----GYEEDLFLRSIGLQMNLIEPRGNNCTEILVWHTQTKSKKL 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B3GAT3NP_036332.2 GlcAT-I 75..313 CDD:132995 100/240 (42%)
Interaction with galactose moiety of substrate glycoprotein 243..252 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..335 1/5 (20%)
GlcAT-SNP_001162922.1 GlcAT-I 208..427 CDD:132995 99/239 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3762
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385244at33208
OrthoFinder 1 1.000 - - FOG0000504
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10896
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.