| Sequence 1: | NP_000811.1 | Gene: | GAS6 / 2621 | HGNCID: | 4168 | Length: | 678 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_524487.2 | Gene: | tld / 42945 | FlyBaseID: | FBgn0003719 | Length: | 1067 | Species: | Drosophila melanogaster |
| Alignment Length: | 335 | Identity: | 74/335 - (22%) |
|---|---|---|---|
| Similarity: | 113/335 - (33%) | Gaps: | 145/335 - (43%) |
- Green bases have known domain annotations that are detailed below.
|
Human 145 KAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFELSSDGRTCQDIDECADSEACG- 208
Human 209 --EARCKN-----------LPGSYSCLCD------------------EG--FAY----------- 229
Human 230 -----------------------SSQEKACR--------------------DVDECL--QGRCEQ 249
Human 250 VCVNSPGSYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSV-------------KSLY----- 296
Human 297 ---LGRMFSGTPVIRLRFKRLQPTR-------LVAEFDFRTFDPEGILLFAGGHQ--------DS 343
Human 344 TWIVLALRAG 353 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GAS6 | NP_000811.1 | Gla | 53..92 | CDD:306960 | |
| EGF_CA | 118..153 | CDD:238011 | 2/7 (29%) | ||
| FXa_inhibition | 160..195 | CDD:317114 | 13/34 (38%) | ||
| EGF_CA | 197..>227 | CDD:214542 | 11/63 (17%) | ||
| vWFA | <232..273 | CDD:320736 | 18/62 (29%) | ||
| LamG | 298..450 | CDD:238058 | 15/71 (21%) | ||
| Laminin_G_2 | 513..651 | CDD:308045 | |||
| tld | NP_524487.2 | ZnMc_BMP1_TLD | 137..338 | CDD:239808 | |
| Astacin | 144..339 | CDD:279708 | |||
| CUB | 388..474 | CDD:214483 | |||
| CUB | 478..586 | CDD:278839 | 2/4 (50%) | ||
| FXa_inhibition | 595..630 | CDD:291342 | 13/34 (38%) | ||
| CUB | 634..750 | CDD:278839 | 13/115 (11%) | ||
| FXa_inhibition | 757..792 | CDD:291342 | 13/36 (36%) | ||
| CUB | 797..906 | CDD:278839 | 20/107 (19%) | ||
| CUB | 910..1023 | CDD:278839 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||