DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAS6 and CG12951

DIOPT Version :9

Sequence 1:NP_000811.1 Gene:GAS6 / 2621 HGNCID:4168 Length:678 Species:Homo sapiens
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:249 Identity:49/249 - (19%)
Similarity:79/249 - (31%) Gaps:98/249 - (39%)


- Green bases have known domain annotations that are detailed below.


Human   451 LNGEDTTIQETVKVNTRMQCFSVTERGSFYPGS---GFAFYSLDYMRTPLDVGTESTWEVEVVAH 512
            :||.|:::.:        ..|.|:.|.  |.||   |.:..|..::.|              .||
  Fly    31 VNGTDSSVLK--------YPFVVSLRS--YDGSHSCGGSIISKHFVMT--------------AAH 71

Human   513 I---RPAADTGVLFAL-----WAPDLRAVPLSVALVDYHSTKKLKKQLVVLAVEHTALALMEIKV 569
            .   |||....:.|.:     ..|::..:...:...|:..|::....:.:|.||.          
  Fly    72 CTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEE---------- 126

Human   570 CDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSA 634
                             ..|.||      ||.|.::           .|.|.||     ||.:.|
  Fly   127 -----------------PFEFDG------VSVAPVE-----------LPALAFA-----VPQSDA 152

Human   635 PVTAFYRGC----------MTL-EVNRRLLDLDEAAYKH---SDITAHSCPPVE 674
            .|.....|.          .|| ||:.::...:|...:|   :|...|.|..|:
  Fly   153 GVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHICGGVD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAS6NP_000811.1 Gla 53..92 CDD:306960
EGF_CA 118..153 CDD:238011
FXa_inhibition 160..195 CDD:317114
EGF_CA 197..>227 CDD:214542
vWFA <232..273 CDD:320736
LamG 298..450 CDD:238058
Laminin_G_2 513..651 CDD:308045 29/156 (19%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 49/249 (20%)
Tryp_SPc 30..260 CDD:238113 49/249 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.