DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAS6 and MP1

DIOPT Version :9

Sequence 1:NP_000811.1 Gene:GAS6 / 2621 HGNCID:4168 Length:678 Species:Homo sapiens
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:268 Identity:61/268 - (22%)
Similarity:96/268 - (35%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    63 REC--VEELCSREEAREVFENDPETDYFYPRYLDCINKYGSPYTKNSGFAT---CVQN------- 115
            |||  :.||...||.       .|.|..:.:...|..:.|....|:..|..   |..|       
  Fly    43 RECGYLFELLQSEEV-------TEQDRRFLQASQCGYRNGQVLEKHFCFTNVQICCANSRMRNQQ 100

Human   116 -------LPDQCTPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQENGGCLQIC-H 172
                   .|.| |..|..|.||:.. .:..|    |...:|.|:...  ||.::.....:.:. :
  Fly   101 PQWGNHPQPTQ-TTKPTKRSGTKLL-PMAPN----CGENFGDRVVGG--NETTKREFPWMALIEY 157

Human   173 NKPGS---FHCSCHSGFELSSDGRTCQDIDEC-----ADSEACGEARCKNLPGSYSCLCDEGFAY 229
            .|||:   .||    |..|.:. |.......|     :|.|..| .|......|.:..|..|   
  Fly   158 TKPGNVKGHHC----GGSLINH-RYVLTAAHCVSAIPSDWELTG-VRLGEWDASTNPDCTVG--- 213

Human   230 SSQEKACRD--VDECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCEDILP-CVPFSVAKS 291
            .:..:.|.:  ||..::.|...  ...||:.....:....|:|..::...:.||| |:| ::|..
  Fly   214 KNGRRDCNEPYVDYPVEERIPH--PQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLP-TLASQ 275

Human   292 VKSLYLGR 299
            ..:::|||
  Fly   276 HNNIFLGR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAS6NP_000811.1 Gla 53..92 CDD:306960 9/30 (30%)
EGF_CA 118..153 CDD:238011 10/34 (29%)
FXa_inhibition 160..195 CDD:317114 8/38 (21%)
EGF_CA 197..>227 CDD:214542 7/34 (21%)
vWFA <232..273 CDD:320736 8/42 (19%)
LamG 298..450 CDD:238058 2/2 (100%)
Laminin_G_2 513..651 CDD:308045
MP1NP_001303421.1 CLIP 29..91 CDD:288855 13/54 (24%)
Tryp_SPc 137..394 CDD:214473 36/161 (22%)
Tryp_SPc 138..397 CDD:238113 35/160 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.