DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32335 and C11orf54

DIOPT Version :9

Sequence 1:NP_728575.2 Gene:CG32335 / 261663 FlyBaseID:FBgn0063667 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001272996.1 Gene:C11orf54 / 28970 HGNCID:30204 Length:315 Species:Homo sapiens


Alignment Length:314 Identity:141/314 - (44%)
Similarity:192/314 - (61%) Gaps:9/314 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ERPLHVPPLSELKRVIQGALDENFRTVDVSVEACPDLRDSQFGLVERGLGGKATLLEAGGPPYLR 79
            |...|||.|.||..|:|..|.:||..|.|||..||||....|....:|:.||..:.|.||.|||.
Human     5 EFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLL 69

  Fly    80 PLVQRDKLYNLKEITRRTQGAGKIFAVGPGAGPWPIRHSNCEGIFNFSLNEEDE---LTQGSYTA 141
            |||.:.|:|:|.:|.:..:..| .|.:|.||||:.....|.|  |...:..|.|   ...|||.|
Human    70 PLVNQKKVYDLNKIAKEIKLPG-AFILGAGAGPFQTLGFNSE--FMPVIQTESEHKPPVNGSYFA 131

  Fly   142 TVRGANEDCVLERIPET--ESRAALILNLFLSEGKPGQVLRISAKQRTGGENFVECIRKGLERHY 204
            .|..|:..|:||:..|.  :.:.||:.|||.|||:||:|:.:.||:|||..|||.|:|:.||:||
Human   132 HVNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHY 196

  Fly   205 GDQVVGLGGMFVVRRGCVHQHVM-RDFSKTPIHTQEQIQNWLKFYEMPAQLNAVGTLVTKDMGLD 268
            |::.:|:||.|::::|.|..|:| .:||..|:::.|::..||.||||.|.|..:...|::|.|.|
Human   197 GNKPIGMGGTFIIQKGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDPGFD 261

  Fly   269 LRLQHFHSFSFANWGGHYHYDTTPDIVEYEAYLNVAERVIRVDRPVATDQLGRD 322
            |||:|.|.||....|||||||||||||||..|...||.:.|:|:|..|..:|||
Human   262 LRLEHTHFFSRHGEGGHYHYDTTPDIVEYLGYFLPAEFLYRIDQPKETHSIGRD 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32335NP_728575.2 DUF1907 31..310 CDD:286069 126/284 (44%)
C11orf54NP_001272996.1 DUF1907 21..303 CDD:312474 126/284 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158952
Domainoid 1 1.000 254 1.000 Domainoid score I2068
eggNOG 1 0.900 - - E1_KOG4048
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8531
Inparanoid 1 1.050 282 1.000 Inparanoid score I2885
Isobase 1 0.950 - 0 Normalized mean entropy S3572
OMA 1 1.010 - - QHG52343
OrthoDB 1 1.010 - - D375938at33208
OrthoFinder 1 1.000 - - FOG0006469
OrthoInspector 1 1.000 - - otm41460
orthoMCL 1 0.900 - - OOG6_107407
Panther 1 1.100 - - O PTHR13204
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4717
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.720

Return to query results.
Submit another query.