DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb7 and RPC25

DIOPT Version :9

Sequence 1:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_012778.1 Gene:RPC25 / 853713 SGDID:S000001627 Length:212 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:34/165 - (20%)
Similarity:65/165 - (39%) Gaps:33/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQPGQGF 65
            ||....:...:.:.|..|....:..:..:|.::.........|..|.:..:..:..|.::||.|.
Yeast     1 MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLKPGDGS 65

  Fly    66 VVYPVKYKAIVFRPFKGEVLDAVVK-------QINKVGMFAEIGPLSCFISHHSIPADMQFCPNG 123
            ....|.::|:||:||.||::...:.       :::.:|:|.:|          .||.:|.|    
Yeast    66 SYINVTFRAVVFKPFLGEIVTGWISKCTAEGIKVSLLGIFDDI----------FIPQNMLF---- 116

  Fly   124 NPPCYKSKDEDVVI-----------SGEDKIRLKI 147
             ..||.:.:|...|           ...:|||.:|
Yeast   117 -EGCYYTPEESAWIWPMDEETKLYFDVNEKIRFRI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 34/165 (21%)
RPC25NP_012778.1 rpoE 1..184 CDD:129540 34/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.