DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb7 and NRPB7

DIOPT Version :9

Sequence 1:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_200726.1 Gene:NRPB7 / 836036 AraportID:AT5G59180 Length:176 Species:Arabidopsis thaliana


Alignment Length:173 Identity:95/173 - (54%)
Similarity:130/173 - (75%) Gaps:1/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQPGQGF 65
            ||:||.||:.:.||||:||..|.|.:..||..:|||||:|::|||:|:|.||.||.|:|:.|.||
plant     1 MFFHIVLERNMQLHPRFFGRNLKENLVSKLMKDVEGTCSGRHGFVVAITGIDTIGKGLIRDGTGF 65

  Fly    66 VVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFCPNGNPPCYKS 130
            |.:||||:.:||||||||:|:|||..:||:|.|||.||:..|:|.|.||.||:| ..|:.|.|.:
plant    66 VTFPVKYQCVVFRPFKGEILEAVVTLVNKMGFFAEAGPVQIFVSKHLIPDDMEF-QAGDMPNYTT 129

  Fly   131 KDEDVVISGEDKIRLKIVGTRVDATGIFAIGTLMDDYLGLVSN 173
            .|..|.|..|.::||||:|||||||.||.:||:.||:||::::
plant   130 SDGSVKIQKECEVRLKIIGTRVDATAIFCVGTIKDDFLGVIND 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 95/171 (56%)
NRPB7NP_200726.1 PTZ00162 1..172 CDD:240298 95/171 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 90 1.000 Domainoid score I2671
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2019
Inparanoid 1 1.050 205 1.000 Inparanoid score I1283
OMA 1 1.010 - - QHG54448
OrthoDB 1 1.010 - - D1140388at2759
OrthoFinder 1 1.000 - - FOG0004872
OrthoInspector 1 1.000 - - oto3765
orthoMCL 1 0.900 - - OOG6_102167
Panther 1 1.100 - - LDO PTHR12709
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3436
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.930

Return to query results.
Submit another query.