DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb7 and NRPE7

DIOPT Version :9

Sequence 1:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001329853.1 Gene:NRPE7 / 827116 AraportID:AT4G14660 Length:178 Species:Arabidopsis thaliana


Alignment Length:171 Identity:52/171 - (30%)
Similarity:93/171 - (54%) Gaps:20/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQPGQGFVVYP 69
            :.|::.||:       :|||....|       ..|.:.|:.:||||:|:||.|.|:...|.|::|
plant    23 LMLKRAILV-------ELLEAFASK-------KATKELGYYVAVTTLDKIGEGKIREHTGEVLFP 73

  Fly    70 VKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPL-SCFISHHSIPADMQFCPNGNPPCYKSKDE 133
            |.:..:.|:.||||::..||.::.|.|:|...||: :.::|:..:| |.::.|..||.....|..
plant    74 VMFSGMTFKIFKGEIIHGVVHKVLKHGVFMRCGPIENVYLSYTKMP-DYKYIPGENPIFMNEKTS 137

  Fly   134 DVVISGEDKIRLKIVGTR-VDATGIF-AIGTLMDDYLGLVS 172
            .:.:  |..:|:.::|.: ::....| |:.:|..||||.:|
plant   138 RIQV--ETTVRVVVIGIKWMEVEREFQALASLEGDYLGPLS 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 52/171 (30%)
NRPE7NP_001329853.1 RNAP_II_Rpb7_N 2..85 CDD:239821 23/75 (31%)
PTZ00162 28..174 CDD:240298 49/162 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140388at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12709
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.