DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb7 and NRPD7

DIOPT Version :9

Sequence 1:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001326806.1 Gene:NRPD7 / 821862 AraportID:AT3G22900 Length:174 Species:Arabidopsis thaliana


Alignment Length:183 Identity:49/183 - (26%)
Similarity:83/183 - (45%) Gaps:25/183 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYHISLEQEI----------LLHPRYFGPQLLETV-KQKLYSEVEGTCTGKYGFVIAVTTIDQI 54
            ||..:.|..::          |:..|....:|||.. |:|        .|...|::|..|.::.|
plant     1 MFIKVKLPWDVTIPAEDMDTGLMLQRAIVIRLLEAFSKEK--------ATKDLGYLITPTILENI 57

  Fly    55 GSGVIQPGQGFVVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLS-CFISHHSIPADMQ 118
            |.|.|:...|.:.:||.:..|.|:.||||::..||.:::|.|:|.:.||.. .::||..:|. .:
plant    58 GEGKIKEQTGEIQFPVVFNGICFKMFKGEIVHGVVHKVHKTGVFLKSGPYEIIYLSHMKMPG-YE 121

  Fly   119 FCPNGNPPCYKSKDEDVVISGEDKIRLKIVGT--RVDATGIFAIGTLMDDYLG 169
            |.|..||.........:.|..  ::|..::.|  |.......|:.::..|.||
plant   122 FIPGENPFFMNQYMSRIQIGA--RVRFVVLDTEWREAEKDFMALASIDGDNLG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 49/183 (27%)
NRPD7NP_001326806.1 RNAP_II_Rpb7_N 2..84 CDD:239821 22/89 (25%)
PTZ00162 <40..174 CDD:240298 40/144 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1140388at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12709
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.