DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb7 and polr2g

DIOPT Version :9

Sequence 1:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001017065.1 Gene:polr2g / 549819 XenbaseID:XB-GENE-1006751 Length:172 Species:Xenopus tropicalis


Alignment Length:172 Identity:141/172 - (81%)
Similarity:157/172 - (91%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQPGQGF 65
            ||||||||.|||||||||||.||.||||||::||||||||||||||||||||.||:||||||:||
 Frog     1 MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGF 65

  Fly    66 VVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFCPNGNPPCYKS 130
            |:|||||||||||||||||:||||.|:||||:|.||||:|||||.||||::|:|.||.||||||:
 Frog    66 VLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKT 130

  Fly   131 KDEDVVISGEDKIRLKIVGTRVDATGIFAIGTLMDDYLGLVS 172
            .||||||..:|:|||||||||||...|||||:||||||||||
 Frog   131 VDEDVVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 141/172 (82%)
polr2gNP_001017065.1 PTZ00162 1..169 CDD:240298 136/167 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5204
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2019
Inparanoid 1 1.050 290 1.000 Inparanoid score I2748
OMA 1 1.010 - - QHG54448
OrthoDB 1 1.010 - - D1140388at2759
OrthoFinder 1 1.000 - - FOG0004872
OrthoInspector 1 1.000 - - oto105525
Panther 1 1.100 - - LDO PTHR12709
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1187
SonicParanoid 1 1.000 - - X3436
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.200

Return to query results.
Submit another query.