DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb7 and CG7339

DIOPT Version :9

Sequence 1:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001261720.1 Gene:CG7339 / 39310 FlyBaseID:FBgn0036188 Length:240 Species:Drosophila melanogaster


Alignment Length:102 Identity:24/102 - (23%)
Similarity:48/102 - (47%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQPGQGF 65
            ||....|:..:.:.|..|..:|::.|:.::..::........|..||:..|..:...:|.||.|.
  Fly     1 MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKDIVSLKDSIILPGDGA 65

  Fly    66 VVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIG 102
            ....|.::.:||||..|.|:...::..::.|:...:|
  Fly    66 SHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVTLG 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 24/102 (24%)
CG7339NP_001261720.1 RPB7 1..212 CDD:224020 24/102 (24%)
RNAP_III_Rpc25_N 2..81 CDD:239822 19/78 (24%)
RNA_pol_Rbc25 79..212 CDD:285491 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444786
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1095
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12709
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.