DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb7 and Polr3h

DIOPT Version :9

Sequence 1:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001120767.1 Gene:Polr3h / 300088 RGDID:1305889 Length:204 Species:Rattus norvegicus


Alignment Length:203 Identity:40/203 - (19%)
Similarity:81/203 - (39%) Gaps:35/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQPGQGF 65
            ||..:.:...:.:.|..|..:|.:::.::|..::........|..|.:..|.::....:.||.|.
  Rat     1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGA 65

  Fly    66 VVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFCPNGNPPC--- 127
            ....|.::.:||.||..|:|...:|..:..|:...:|    |.....||.:....|......   
  Rat    66 SHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLG----FFDDILIPPESLQQPAKFDEAEQV 126

  Fly   128 ----YKSKD--EDVVISGEDKIRLKIVG-TRVDA--TG-------------------IFAIGTLM 164
                |::::  .|:.:...::||.::|. :.||.  ||                   ...:|::.
  Rat   127 WVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEAASSSEELPKKEAPYTLVGSIS 191

  Fly   165 DDYLGLVS 172
            :..|||:|
  Rat   192 EPGLGLLS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 40/203 (20%)
Polr3hNP_001120767.1 RNAP_III_Rpc25_N 2..81 CDD:239822 15/78 (19%)
RNA_pol_Rbc25 83..201 CDD:400543 23/121 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.