DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb7 and rpb7

DIOPT Version :9

Sequence 1:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001342741.1 Gene:rpb7 / 2542097 PomBaseID:SPACUNK4.06c Length:172 Species:Schizosaccharomyces pombe


Alignment Length:173 Identity:91/173 - (52%)
Similarity:122/173 - (70%) Gaps:6/173 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAV---TTIDQIGSGVIQPGQ 63
            |:...|...|.|||.||||::.:.:|.||.::|||||:|:||::|.|   .||| |..|.:.|||
pombe     3 FFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTID-IDKGRVVPGQ 66

  Fly    64 GFVVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFCPNGNPPCY 128
            ||..:.|||:|:::|||:|||:||:|..:||:|.||.||||:.|:|.|.:|.||:|.|..|||.|
pombe    67 GFAEFEVKYRAVLWRPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNY 131

  Fly   129 KSKDEDVVISGEDKIRLKIVGTRVDATGIFAIGTLMDDYLGLV 171
            ..  ||.||.....:||||||||.|||.||||.|:.:||||::
pombe   132 SG--EDQVIEKGSNVRLKIVGTRTDATEIFAIATMKEDYLGVL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 91/173 (53%)
rpb7NP_001342741.1 RPB7 2..172 CDD:224020 91/171 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 93 1.000 Domainoid score I1987
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2019
Inparanoid 1 1.050 184 1.000 Inparanoid score I1098
OMA 1 1.010 - - QHG54448
OrthoFinder 1 1.000 - - FOG0004872
OrthoInspector 1 1.000 - - oto102140
orthoMCL 1 0.900 - - OOG6_102167
Panther 1 1.100 - - LDO PTHR12709
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1187
SonicParanoid 1 1.000 - - X3436
TreeFam 1 0.960 - -
1312.950

Return to query results.
Submit another query.