DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb7 and rpc-25

DIOPT Version :9

Sequence 1:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_505625.1 Gene:rpc-25 / 179418 WormBaseID:WBGene00014111 Length:239 Species:Caenorhabditis elegans


Alignment Length:163 Identity:45/163 - (27%)
Similarity:67/163 - (41%) Gaps:20/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQPGQGF 65
            ||....|...:.:.|..........:|::|...:........|..|.|..|::||...|.||:|.
 Worm     1 MFILSLLHDTVAIQPHQLSSDQQIVIKKRLNERLANKIIPDLGLCICVYDINEIGDSYILPGEGD 65

  Fly    66 VVYPVKYKAIVFRPFKGEVLDAVVKQINKVGM------FAEIGPLSCFISHHSIPADMQFCPNGN 124
            ....||::.||||||..||::|.|...::.|:      |.:|     |:....:|....|...|.
 Worm    66 CRARVKFRMIVFRPFVDEVIEAKVIGSSRQGLCLTIQFFEDI-----FVPAEKLPEPHVFEEEGQ 125

  Fly   125 PPCYKSKDEDVVISGEDKIRL-----KIVGTRV 152
            ...::...||    ||...:|     |||..||
 Worm   126 VWYWEYAQED----GEPPAKLYMDPGKIVRFRV 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 45/163 (28%)
rpc-25NP_505625.1 RPB7 1..194 CDD:224020 45/163 (28%)
RNAP_III_Rpc25_N 2..81 CDD:239822 22/78 (28%)
RNA_pol_Rbc25 79..194 CDD:285491 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.