DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb7 and rpb-7

DIOPT Version :9

Sequence 1:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_491093.1 Gene:rpb-7 / 171877 WormBaseID:WBGene00021845 Length:197 Species:Caenorhabditis elegans


Alignment Length:170 Identity:121/170 - (71%)
Similarity:146/170 - (85%) Gaps:0/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQPGQGF 65
            ||:|:||:.|:.|||:||||.|.||:|.||::||||||||||||||||||||.||.|:||||:||
 Worm    24 MFFHLSLDHEVCLHPKYFGPNLNETIKMKLFNEVEGTCTGKYGFVIAVTTIDTIGHGLIQPGRGF 88

  Fly    66 VVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFCPNGNPPCYKS 130
            |:|||:|||||||||||:|:|.||.|:||||:|.:|||||||||.|.||.||:|.||...||||:
 Worm    89 VIYPVRYKAIVFRPFKGQVVDGVVTQVNKVGIFCDIGPLSCFISRHCIPPDMEFDPNSEKPCYKT 153

  Fly   131 KDEDVVISGEDKIRLKIVGTRVDATGIFAIGTLMDDYLGL 170
            .||..||..:|:||:|::||||||..||||||||||:|||
 Worm   154 NDEANVIRNDDEIRVKLIGTRVDANDIFAIGTLMDDFLGL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 121/170 (71%)
rpb-7NP_491093.1 PTZ00162 24..192 CDD:240298 118/167 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166664
Domainoid 1 1.000 118 1.000 Domainoid score I3656
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2019
Inparanoid 1 1.050 266 1.000 Inparanoid score I1872
Isobase 1 0.950 - 0 Normalized mean entropy S329
OMA 1 1.010 - - QHG54448
OrthoDB 1 1.010 - - D1140388at2759
OrthoFinder 1 1.000 - - FOG0004872
OrthoInspector 1 1.000 - - oto19821
orthoMCL 1 0.900 - - OOG6_102167
Panther 1 1.100 - - LDO PTHR12709
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1187
SonicParanoid 1 1.000 - - X3436
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.840

Return to query results.
Submit another query.