Sequence 1: | NP_731983.1 | Gene: | Rpb7 / 261631 | FlyBaseID: | FBgn0051155 | Length: | 173 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018060.1 | Gene: | POLR3H / 171568 | HGNCID: | 30349 | Length: | 204 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 39/203 - (19%) |
---|---|---|---|
Similarity: | 80/203 - (39%) | Gaps: | 35/203 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQPGQGF 65
Fly 66 VVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFCPNGNPPC--- 127
Fly 128 ----YKSKD--EDVVISGEDKIRLKIVG-----------TRVDAT-----------GIFAIGTLM 164
Fly 165 DDYLGLVS 172 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rpb7 | NP_731983.1 | PTZ00162 | 1..173 | CDD:240298 | 39/203 (19%) |
POLR3H | NP_001018060.1 | RNAP_III_Rpc25_N | 2..81 | CDD:239822 | 15/78 (19%) |
RNA_pol_Rbc25 | 83..201 | CDD:400543 | 22/121 (18%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 158..179 | 3/20 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1095 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |