DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb7 and POLR3H

DIOPT Version :9

Sequence 1:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001018060.1 Gene:POLR3H / 171568 HGNCID:30349 Length:204 Species:Homo sapiens


Alignment Length:203 Identity:39/203 - (19%)
Similarity:80/203 - (39%) Gaps:35/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQPGQGF 65
            ||..:.:...:.:.|..|..:|.:::.::|..::........|..|.:..|.::....:.||.|.
Human     1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGA 65

  Fly    66 VVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFCPNGNPPC--- 127
            ....|.::.:||.||..|:|...:|..:..|:...:|    |.....||.:....|......   
Human    66 SHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLG----FFDDILIPPESLQQPAKFDEAEQV 126

  Fly   128 ----YKSKD--EDVVISGEDKIRLKIVG-----------TRVDAT-----------GIFAIGTLM 164
                |::::  .|:.:...::||.::|.           :..|||           ....:|::.
Human   127 WVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVGSIS 191

  Fly   165 DDYLGLVS 172
            :..|||:|
Human   192 EPGLGLLS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 39/203 (19%)
POLR3HNP_001018060.1 RNAP_III_Rpc25_N 2..81 CDD:239822 15/78 (19%)
RNA_pol_Rbc25 83..201 CDD:400543 22/121 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..179 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.