DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31469 and LOC691592

DIOPT Version :9

Sequence 1:NP_731853.2 Gene:CG31469 / 261628 FlyBaseID:FBgn0051469 Length:164 Species:Drosophila melanogaster
Sequence 2:XP_017446043.1 Gene:LOC691592 / 691592 RGDID:1582722 Length:143 Species:Rattus norvegicus


Alignment Length:129 Identity:54/129 - (41%)
Similarity:74/129 - (57%) Gaps:7/129 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLFVCIGNTCRSPMAEAILKHLVVKRNLQD-WYVDSAGLRSWNVGLEPQARGQQLLKQHGLKTNH 66
            |||||:.|...||:|.|:.:.||...|:.| |.:||..:.:||||..|..|....|:.||:.|.|
  Rat     9 VLFVCLSNIYWSPIAVAVFRKLVTNENVSDNWAIDSRAVSNWNVGQTPDPRAVSCLRNHGISTAH 73

  Fly    67 LGRMISAQDFYDFDYIFAMDNSNLLELEHMAASLTPSPTC--KIQLLGSYIGRKEDEIIEDPYF 128
            ..|.|:.:||..||||..||.:||.:|...:..:   ..|  ||:|.|||..:|: .|.||||:
  Rat    74 KARQITREDFATFDYILCMDENNLRDLNRKSNQV---KNCRAKIELPGSYDPQKQ-LIFEDPYY 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31469NP_731853.2 LMWPc 1..151 CDD:238063 54/129 (42%)
LOC691592XP_017446043.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362234at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.