DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31469 and acp1

DIOPT Version :9

Sequence 1:NP_731853.2 Gene:CG31469 / 261628 FlyBaseID:FBgn0051469 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001014324.2 Gene:acp1 / 541489 ZFINID:ZDB-GENE-050327-12 Length:158 Species:Danio rerio


Alignment Length:155 Identity:66/155 - (42%)
Similarity:90/155 - (58%) Gaps:10/155 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLFVCIGNTCRSPMAEAILKHLVVKRNLQD-WYVDSAGLRSWNVGLEPQARGQQLLKQHGLKTNH 66
            |||||:||.||||:|||:.:.:.....:.| |.:||.....||.|..|.|||...|::||::|:|
Zfish     9 VLFVCLGNICRSPIAEAVFRKMATDSGVVDKWVIDSGATSDWNTGSTPDARGLACLRKHGIETDH 73

  Fly    67 LGRMISAQDFYDFDYIFAMDNSNLLELEHMAASLTPSPTCKIQLLGSYIGRKEDEIIEDPYFIQG 131
            ..|.::..||..||||..||.|||.:|...|:|:..| ..||:|||||...|: .||:|||:   
Zfish    74 RARQVTKDDFMSFDYILCMDESNLRDLNKKASSVKNS-KAKIELLGSYDPEKQ-LIIQDPYY--- 133

  Fly   132 MGG---FNAAYLQILESCERFLQHY 153
             |.   |...|.|....|:.||:.:
Zfish   134 -GSDKDFETVYEQCARCCKAFLEQH 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31469NP_731853.2 LMWPc 1..151 CDD:238063 65/151 (43%)
acp1NP_001014324.2 LMWPc 7..155 CDD:238063 65/151 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578727
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62674
OrthoDB 1 1.010 - - D1362234at2759
OrthoFinder 1 1.000 - - FOG0001845
OrthoInspector 1 1.000 - - otm25621
orthoMCL 1 0.900 - - OOG6_101411
Panther 1 1.100 - - O PTHR11717
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2237
SonicParanoid 1 1.000 - - X1374
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.