DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31469 and acp1

DIOPT Version :9

Sequence 1:NP_731853.2 Gene:CG31469 / 261628 FlyBaseID:FBgn0051469 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001005082.1 Gene:acp1 / 448657 XenbaseID:XB-GENE-973004 Length:157 Species:Xenopus tropicalis


Alignment Length:150 Identity:65/150 - (43%)
Similarity:91/150 - (60%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLFVCIGNTCRSPMAEAILKHLVVKRNL-QDWYVDSAGLRSWNVGLEPQARGQQLLKQHGLKTNH 66
            |||||:||.||||:|||:.:.||..... ::|.:|||....||||..|.:|..:.||.||::|.|
 Frog     9 VLFVCLGNICRSPIAEAVFRKLVTDAGTSKEWSIDSAATSDWNVGSSPDSRALKCLKSHGIETAH 73

  Fly    67 LGRMISAQDFYDFDYIFAMDNSNLLELEHMAASLTPSPTCKIQLLGSYIGRKEDEIIEDPYFIQG 131
            ..:.|:..||..:|||..||.|||.:|:...:.:..| ..||:|||||..:|: .||||||:.:.
 Frog    74 RAQQITRDDFLSYDYILCMDESNLRDLKRKGSQVQNS-KAKIELLGSYDPQKK-LIIEDPYYGRD 136

  Fly   132 MGGFNAAYLQILESCERFLQ 151
             ..|...|.|.:..|:.||:
 Frog   137 -EDFETVYQQCIRCCKSFLE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31469NP_731853.2 LMWPc 1..151 CDD:238063 64/148 (43%)
acp1NP_001005082.1 LMWPTP 7..155 CDD:319971 64/148 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362234at2759
OrthoFinder 1 1.000 - - FOG0001845
OrthoInspector 1 1.000 - - otm47992
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2237
SonicParanoid 1 1.000 - - X1374
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.