DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31469 and primo-2

DIOPT Version :9

Sequence 1:NP_731853.2 Gene:CG31469 / 261628 FlyBaseID:FBgn0051469 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001027188.1 Gene:primo-2 / 3772427 FlyBaseID:FBgn0040076 Length:164 Species:Drosophila melanogaster


Alignment Length:151 Identity:68/151 - (45%)
Similarity:96/151 - (63%) Gaps:6/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLFVCIGNTCRSPMAEAILKHLVVKRNLQ-DWYVDSAGLRSWNVGLEPQARGQQLLKQHGLKTNH 66
            ||.||:||.||||:|||:::.||.:..|| :|:|:|||:..|:.|.:|..|...:|.:|.::.|.
  Fly    10 VLMVCVGNLCRSPIAEAVMRDLVARAGLQGEWHVESAGIEDWHSGHQPDERALNVLARHNIEYNG 74

  Fly    67 LGRMISAQDFYDFDYIFAMDNSNLLELEHMAASLTPSPTCKIQLLGSYIGRKEDE-IIEDPYFIQ 130
            ..|:::.:||.:||||||||.|||..|..||...|   |.|:.:||:: |.|.|| ||||||:..
  Fly    75 KARVLAPEDFLEFDYIFAMDLSNLAALRRMAPKGT---TAKLLILGNF-GLKPDERIIEDPYYDI 135

  Fly   131 GMGGFNAAYLQILESCERFLQ 151
            |...|...|.|...:|..||:
  Fly   136 GEASFEEIYRQCSIACRNFLK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31469NP_731853.2 LMWPc 1..151 CDD:238063 67/149 (45%)
primo-2NP_001027188.1 LMWPc 9..156 CDD:238063 67/149 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446178
Domainoid 1 1.000 85 1.000 Domainoid score I2819
eggNOG 1 0.900 - - E1_COG0394
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2255
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001845
OrthoInspector 1 1.000 - - otm25621
orthoMCL 1 0.900 - - OOG6_101411
Panther 1 1.100 - - P PTHR11717
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2237
SonicParanoid 1 1.000 - - X1374
1110.820

Return to query results.
Submit another query.