DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31469 and stp1

DIOPT Version :9

Sequence 1:NP_731853.2 Gene:CG31469 / 261628 FlyBaseID:FBgn0051469 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001342920.1 Gene:stp1 / 3361433 PomBaseID:SPAC1071.12c Length:156 Species:Schizosaccharomyces pombe


Alignment Length:153 Identity:62/153 - (40%)
Similarity:94/153 - (61%) Gaps:6/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLFVCIGNTCRSPMAEAILKHLVVKRNLQDWY--VDSAGLRSWNVGLEPQARGQQLLKQHGLK 63
            ::|||||:||.||||||||:.::.|.|..|:..:  :||.|..:|:||..|..|..::||::|:.
pombe     5 IQVLFVCLGNICRSPMAEAVFRNEVEKAGLEARFDTIDSCGTGAWHVGNRPDPRTLEVLKKNGIH 69

  Fly    64 TNHLGRMISAQDFYDFDYIFAMDNSNLLELEHMAASLTPSPTCKIQLLGSYIGRKEDEIIEDPYF 128
            |.||.|.:|..||.:||||||||:|||..:..:...   ....|:.|.|.|......:|::|||:
pombe    70 TKHLARKLSTSDFKNFDYIFAMDSSNLRNINRVKPQ---GSRAKVMLFGEYASPGVSKIVDDPYY 131

  Fly   129 IQGMGGFNAAYLQILESCERFLQ 151
             .|..||...|:|:::..:.||:
pombe   132 -GGSDGFGDCYIQLVDFSQNFLK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31469NP_731853.2 LMWPc 1..151 CDD:238063 61/151 (40%)
stp1NP_001342920.1 LMWPTP 7..153 CDD:319971 61/149 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62674
OrthoFinder 1 1.000 - - FOG0001845
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101411
Panther 1 1.100 - - O PTHR11717
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2237
SonicParanoid 1 1.000 - - X1374
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.