DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31469 and Acp1

DIOPT Version :9

Sequence 1:NP_731853.2 Gene:CG31469 / 261628 FlyBaseID:FBgn0051469 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001103709.1 Gene:Acp1 / 11431 MGIID:87881 Length:158 Species:Mus musculus


Alignment Length:152 Identity:67/152 - (44%)
Similarity:88/152 - (57%) Gaps:8/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLFVCIGNTCRSPMAEAILKHLVVKRNLQD-WYVDSAGLRSWNVGLEPQARGQQLLKQHGLKTNH 66
            |||||:||.||||:|||:.:.||....:.| |.:||:.:..||||..|..|....|:.||:.|.|
Mouse     9 VLFVCLGNICRSPIAEAVFRKLVTDEKVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAH 73

  Fly    67 LGRMISAQDFYDFDYIFAMDNSNLLELEHMAASLTPSPTC--KIQLLGSYIGRKEDEIIEDPYFI 129
            ..|.|:.:||..||||..||.|||.:|...:..:   ..|  ||:|||||..:|: .||||||: 
Mouse    74 KARQITKEDFATFDYILCMDESNLRDLNRKSNQV---KNCKAKIELLGSYDPQKQ-LIIEDPYY- 133

  Fly   130 QGMGGFNAAYLQILESCERFLQ 151
            .....|...|.|.|..|:.||:
Mouse   134 GNDSDFEVVYQQCLRCCKAFLE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31469NP_731853.2 LMWPc 1..151 CDD:238063 66/150 (44%)
Acp1NP_001103709.1 LMWPTP 7..155 CDD:319971 66/150 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835517
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1257
OMA 1 1.010 - - QHG62674
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001845
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101411
Panther 1 1.100 - - O PTHR11717
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2237
SonicParanoid 1 1.000 - - X1374
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.690

Return to query results.
Submit another query.