DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31495 and SAP1

DIOPT Version :10

Sequence 1:NP_731866.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_010966.1 Gene:SAP1 / 856771 SGDID:S000000849 Length:897 Species:Saccharomyces cerevisiae


Alignment Length:92 Identity:24/92 - (26%)
Similarity:42/92 - (45%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LVEGKPKSGLTTVAAQMALKTDCPFIKYISSAELLG--LSDSEKCQRIREVLEDAYVSRRSCVII 191
            |:.|.|.:|.|.:|..:|.::...|.. ||::.|..  |.:|||.  :|.:...|.....|.:.:
Yeast   642 LLFGPPGTGKTMLARAVATESHSTFFS-ISASSLTSKYLGESEKL--VRALFAIAKKLSPSIIFV 703

  Fly   192 DDFERVIG------YGALGKRYSKEFL 212
            |:.:.::|      .....:|...|||
Yeast   704 DEIDSIMGSRNNENENESSRRIKNEFL 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31495NP_731866.1 SpoVK <1..88 CDD:440232
AAA 129..257 CDD:459627 24/92 (26%)
SAP1NP_010966.1 Herpes_BLLF1 <353..543 CDD:282904
McrB <539..>659 CDD:441011 6/16 (38%)
RecA-like_VPS4-like 607..788 CDD:410917 24/92 (26%)
AAA_lid_3 815..850 CDD:465537
Vps4_C <847..893 CDD:462762
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.