DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31495 and CDC48C

DIOPT Version :10

Sequence 1:NP_731866.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001326134.1 Gene:CDC48C / 821105 AraportID:AT3G01610 Length:830 Species:Arabidopsis thaliana


Alignment Length:245 Identity:56/245 - (22%)
Similarity:100/245 - (40%) Gaps:62/245 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LVEGKPKSGLTTVAAQMALKTDCPFIKYISSAELL-GLSDSEKCQRIREVLEDAYVSRRSCVIID 192
            |..|.|..|.|.:|..:|.:...||.| ||:.|:: |:|.:.: :.|||:...||.:..|.|.||
plant   271 LFHGPPGCGKTKLANAIANEAGVPFYK-ISATEVISGVSGASE-ENIRELFSKAYRTAPSIVFID 333

  Fly   193 DFERVIGYGALGKRYSKEFLQKLTVLL-----------KKQPPNSHE--LIIICTSNRLDVLE-- 242
            :.:.:   |:..:...:|..:::...|           .|..|:|..  :::|..:||.|.|:  
plant   334 EIDAI---GSKRENQQREMEKRIVTQLLTCMDGPGNKGDKNAPDSSAGFVLVIGATNRPDALDPA 395

  Fly   243 ---------ELGLLSVFTSVHNVPNVSTPKELMVIVEASKRFE-PEELRQIE------IAMDGRN 291
                     |:.|        ..|:.....|::.:|....|.| |.:.::|.      :..|..:
plant   396 LRRSGRFETEIAL--------TAPDEDARAEILSVVAQKLRLEGPFDKKRIARLTPGFVGADLES 452

  Fly   292 VSI-----GIKRLLDL------------IAWVNSLNPDRRAAKLLKKLGE 324
            |:.     .|||:||.            .:|:....|:....||..|:.:
plant   453 VAYLAGRKAIKRILDSRKSEQSGDGEDDKSWLRMPWPEEELEKLFVKMSD 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31495NP_731866.1 SpoVK <1..88 CDD:440232
AAA 129..257 CDD:459627 37/152 (24%)
CDC48CNP_001326134.1 CDC48 <223..808 CDD:273521 56/245 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.